Recombinant Yarrowia lipolytica Mitochondrial outer membrane protein IML2 (IML2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and storing in aliquots at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your requirements for preferential development of a specific tag.
Synonyms
IML2; YALI0F29491g; Inclusion body clearance protein IML2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-721
Protein Length
full length protein
Species
Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica)
Target Names
IML2
Target Protein Sequence
MLKALGLGKRGGDMPTKPLNNSTVSLAIMDDALRVEEAFIAMDMVMDDRSKEALKLIQKD EPGSSGKSVAREQSAFYKLVIGVIYFIEATLGFEPESIRRASEALAEAEAAAVRQKRNVS NNGAHVSYSKYPPGTEYRVAFAEAELMGAITLFLSESYLESVKALYKLRKAYQTLDEISK SIRESKKPAKSSDHKSTLDSLSLAVSDDQEMASLVEKFQKTRLNRLNESNNATPVASSAA SMNTTTSSATALHQGSETIEEFIESGVDLCFGILQLVISIIPPTLGKILSVVGFRGSRDG GLSLLWEATNYRNIHGALALLVLLQFYDGPTQFSDLILPGTEEDLIQQGKYDINTADDTE ITLTATITGGSGHSKKVHTLPKNPRRRMHKLLLAARGYYPHSALWMLQQGRMEASQCHLE KAVDIMDADIGPIEMKQVEALMLFDKTMFMLFLNRYEQSATNFIRLIDINAWSHAWYTYV AATCSIEIYRENLRAGNAEAAKKAKDTATRLLTEAPGLIGKKKLMAKTMPMDVFLSRKIS QMQQLSKQHNIDLVDAAGVSPVQEVVYFWNGYGKMPEYALEKVFSEVLAYSAAPLAPSHI PEQDNEKTVRHLLQAVALRNMGKVEEGYKILNDNVISQIITESNNKYHYNKTVTHKDPWM PPSALYERAMFEWVMHGPKGTETVREWLHLAEKWSDDYELSTRVGMKIKSAFERLDGGAL A
Uniprot No.

Target Background

Function
IML2 is an inclusion body (IB)-resident mitochondrial outer membrane protein that exhibits strong interaction with lipid droplet (LD) proteins. It plays a role in LD-mediated IB clearance following protein folding stress, likely by facilitating access of an LD-stored, soluble sterol derivative (acting as a chaperone) to the IBs for clearance.
Database Links
Protein Families
IML2 family
Subcellular Location
Cytoplasm. Nucleus.

Q&A

Advanced Research Questions

  • What expression systems are most effective for recombinant IML2 protein production?

    Based on available data and general principles for mitochondrial membrane protein expression, the following systems can be considered:

    Expression SystemAdvantagesDisadvantagesNotes for IML2
    E. coliFast growth, high yields, cost-effective, established protocolsPotential misfolding, lack of post-translational modifications, inclusion body formationSuccessfully used for IML2 with N-terminal His-tag; requires optimization of induction conditions
    Y. lipolyticaNative environment, proper folding, authentic post-translational modificationsLower yields, more complex manipulation, longer production timesCan use integrative multi-copy expression vectors with pICL1 promoter as described for other mitochondrial proteins
    P. pastorisEukaryotic processing, high density cultures, methanol-inducible promoterModerate yields, glycosylation may differNot specifically documented for IML2 but suitable for membrane proteins
    Insect cellsSuperior folding for complex eukaryotic proteins, scalableHigher cost, technical complexity, longer timelineBeneficial for structural studies of membrane proteins

    For IML2 specifically, E. coli expression with N-terminal His-tagging has been documented as successful, with protein stored in Tris/PBS-based buffer containing 6% Trehalose at pH 8.0 . Alternative expression in Y. lipolytica itself could provide native-like protein but would require adaptation of the multi-copy integration system described for steroidogenic proteins .

  • What strategies can optimize purification of recombinant IML2 protein?

    Successful purification of IML2 requires strategies tailored to membrane proteins:

    • Affinity chromatography using the N-terminal His-tag provides efficient initial capture (immobilized metal affinity chromatography)

    • Solubilization requires careful detergent selection—mild detergents like DDM (n-dodecyl-β-D-maltoside) or LDAO (lauryldimethylamine oxide) are recommended for maintaining native structure

    • Buffer optimization should include:

      • Tris/PBS-based buffer at pH 8.0

      • Addition of 6% Trehalose as a stabilizer

      • 50% glycerol for long-term storage

    • Size exclusion chromatography as a second purification step removes aggregates and improves homogeneity

    • Avoid repeated freeze-thaw cycles; store working aliquots at 4°C for up to one week

    • For membrane reconstitution, addition of phosphatidylcholine may help restore native activity (400-500 molecules per protein complex has proven effective for other Y. lipolytica mitochondrial proteins)

    • Reconstitution into nanodiscs or liposomes may improve stability for functional and structural studies

  • How can I design experimental approaches to characterize IML2 function?

    A systematic experimental strategy would include:

    1. Genetic approaches:

      • Generate deletion strains using homologous recombination techniques

      • Create conditional expression systems for essential functions

      • Develop a complementation system using the two-step approach for constructing recombinant strains

      • Apply site-directed mutagenesis to key residues

    2. Localization studies:

      • Fusion with fluorescent proteins for in vivo localization

      • Immunogold electron microscopy for precise submitochondrial localization

      • Subcellular fractionation and Western blotting

    3. Interaction studies:

      • Affinity purification-mass spectrometry to identify binding partners

      • Co-immunoprecipitation with antibodies against IML2

      • Crosslinking followed by MS identification

    4. Functional analysis:

      • Assess mitochondrial morphology in knockout/knockdown cells

      • Measure respiratory chain activity in IML2-deficient cells

      • Analyze mitochondrial membrane potential using fluorescent dyes

      • Examine mtDNA stability and nucleoid organization

    This multi-faceted approach follows experimental design principles that systematically test hypotheses about IML2 function while controlling for variables that might influence results .

  • What techniques are most effective for studying protein-protein interactions involving IML2?

    Several complementary techniques can reveal IML2's interaction network:

    TechniqueApplication for IML2ControlsAdvantages
    Affinity purification-MSComprehensive identification of interaction partnersNon-specific binding controls (empty vector)Identifies complete interactome
    Co-immunoprecipitationValidation of specific interactionsIgG control, input controlsConfirms interactions under native conditions
    Proximity labeling (BioID/APEX)In vivo detection of proximal proteinsNon-targeting construct controlsIdentifies transient interactions
    Crosslinking-MSMapping interaction interfacesNon-crosslinked samplesProvides structural information
    Yeast two-hybridScreening for direct interactionsEmpty vector, known interactorsHigh-throughput screening capability
    Split fluorescent protein systemsIn vivo visualization of interactionsNegative control protein pairsDirect visualization in native environment

    For membrane proteins like IML2, techniques that maintain the native membrane environment (proximity labeling, crosslinking) may provide more reliable results than those requiring solubilization. The dual approach of comprehensive screening followed by targeted validation has proven successful for characterizing other mitochondrial membrane protein complexes .

  • What challenges exist in studying recombinant mitochondrial membrane proteins from Y. lipolytica?

    Researchers face several significant challenges when working with IML2 and similar proteins:

    • Expression difficulties: Membrane proteins often exhibit toxicity to host cells when overexpressed, necessitating careful regulation of expression levels

    • Proper folding: Ensuring correct insertion into membranes in heterologous systems requires optimization of expression conditions

    • Solubilization issues: Maintaining native conformation during extraction from membranes demands extensive detergent screening

    • Low yields: Membrane proteins typically produce lower yields than soluble proteins, requiring scale-up of production

    • Purification complexity: Multiple chromatography steps may be needed to achieve high purity while maintaining activity

    • Functional reconstitution: Restoring native activity often requires incorporation into artificial membranes or addition of specific lipids

    • Structural analysis limitations: Crystallization of membrane proteins for structural studies presents significant technical hurdles

    • Species-specific factors: Y. lipolytica has unique mitochondrial characteristics that may not be replicated in heterologous systems

    These challenges necessitate careful optimization at each step of the experimental workflow, from gene design through functional analysis.

  • How can site-directed mutagenesis be applied to study structure-function relationships in IML2?

    A systematic mutagenesis approach would include:

    • Sequence analysis: Identify conserved residues through multiple sequence alignment with orthologs from related species

    • Domain mapping: Generate truncation mutants to identify functional domains (transmembrane regions, interaction surfaces)

    • Targeted mutations:

      • Convert key hydrophobic residues in transmembrane domains to assess membrane integration

      • Mutate potential phosphorylation sites to investigate regulation

      • Alter conserved charged residues that may participate in protein-protein interactions

    • Complementation testing: Introduce mutated constructs into IML2-deficient strains to assess functional rescue

    • Expression verification: Confirm expression of mutant proteins by Western blotting

    • Localization analysis: Ensure proper targeting of mutants to mitochondria using fluorescent protein fusions

    The two-step approach for constructing recombinant strains described for Y. lipolytica provides an effective framework for introducing and testing multiple mutations. This approach has successfully identified functionally important amino acids in other mitochondrial proteins from this organism .

Methodological Questions

  • What approaches verify proper folding and quality of purified recombinant IML2?

    Quality assessment of recombinant IML2 should include multiple complementary techniques:

    • Gel filtration chromatography: Evaluates homogeneity and oligomeric state; properly folded protein should elute as a symmetrical peak at the expected molecular weight

    • Circular dichroism (CD) spectroscopy: Assesses secondary structure content; membrane proteins typically show characteristic α-helical signatures

    • Fluorescence-detected size exclusion chromatography (FSEC): Particularly valuable for membrane proteins, monitors protein quality without the need for purification

    • Thermal shift assays: Properly folded proteins typically exhibit cooperative unfolding transitions

    • Limited proteolysis: Well-folded proteins show resistance to proteolytic degradation except at exposed flexible regions

    • Functional assays: If specific activity is known, activity measurements provide the ultimate validation of proper folding

    • Binding assays: Interaction with known binding partners confirms functional conformation

    These approaches should be used in combination to provide a comprehensive assessment of protein quality before proceeding to functional or structural studies.

  • How can I design experiments to study IML2's role in mitochondrial disease models?

    A comprehensive experimental strategy would include:

    1. Genetic manipulation in Y. lipolytica:

      • Generate IML2 deletion or conditional expression strains

      • Create point mutations corresponding to disease-associated variants in related proteins

      • Develop reporter systems for mitochondrial function

    2. Functional characterization:

      • Measure respiratory chain activity using oxygen consumption rate measurements

      • Assess mitochondrial membrane potential using fluorescent dyes (JC-1, TMRM)

      • Quantify reactive oxygen species production using specific probes

      • Analyze mitochondrial morphology using fluorescence and electron microscopy

      • Measure mtDNA stability, copy number, and nucleoid organization

    3. Drug response studies:

      • Apply the drug repurposing screen approach developed for Y. lipolytica

      • Test sensitivity to mitochondrial toxins and stressors

      • Screen for compounds that rescue phenotypes in IML2-deficient cells

      • Validate hits in secondary assays measuring specific mitochondrial functions

    4. Comparative analysis:

      • Extend findings to mammalian models through complementation studies

      • Express human orthologs in Y. lipolytica IML2 deletion strains

      • Compare phenotypes with known mitochondrial disease models

    This approach leverages Y. lipolytica's advantages as a model system while providing translational relevance to human mitochondrial disorders .

  • What techniques best identify and validate IML2 protein interactions within mitochondrial membranes?

    Identifying authentic interactions within membrane environments requires specialized approaches:

    • Proximity-based labeling: BioID or APEX2 fused to IML2 allows in vivo biotinylation of neighboring proteins, followed by streptavidin pulldown and mass spectrometry analysis

    • Crosslinking mass spectrometry: Chemical crosslinkers (DSS, BS3) or photo-crosslinkers stabilize interactions before extraction from membranes

    • Co-purification under native conditions: Mild detergent solubilization followed by affinity purification can maintain intact complexes

    • Blue native PAGE: Separates intact membrane protein complexes while preserving native interactions

    • Förster resonance energy transfer (FRET): When combined with appropriate fluorophore pairs, allows detection of interactions in living cells

    • Split-protein complementation assays: Systems like split-GFP or split-luciferase can validate specific interactions in vivo

    • Co-localization studies: Super-resolution microscopy can identify proteins that co-localize with IML2 at nanometer resolution

    Validation should include reciprocal pulldowns, competition assays, and mutation of predicted interaction surfaces to confirm specificity . The established methods for purification of mitochondrial complexes from Y. lipolytica provide a useful framework for these studies .

  • What are the optimal approaches for structural characterization of IML2?

    Structural analysis of membrane proteins like IML2 presents unique challenges requiring specialized techniques:

    MethodResolutionAdvantagesLimitationsApplicability to IML2
    X-ray crystallographyAtomic (1-3Å)Highest resolution possibleDifficult crystallization of membrane proteinsChallenging but potentially achievable with lipidic cubic phase methods
    Cryo-electron microscopyNear-atomic (2-4Å)Works with smaller samples, captures multiple conformationsRequires homogeneous samplesHighly suitable; has been successful for other Y. lipolytica membrane proteins
    NMR spectroscopyAtomic for domainsGood for dynamics studiesSize limitations, challenging for full membrane proteinsApplicable for soluble domains of IML2
    Hydrogen-deuterium exchange MSPeptide-levelWorks with membrane proteins in native environmentsLower resolutionExcellent for mapping exposed regions and conformational changes
    Molecular modelingVariableCan predict structure based on homologyAccuracy depends on template qualityUseful for generating testable hypotheses
    Crosslinking-MSResidue pairsProvides distance constraintsLimited to accessible residuesValuable for validating models

    The success of cryo-EM for other Y. lipolytica mitochondrial complexes suggests this approach may be particularly promising for IML2, especially if it forms part of a larger complex . A hybrid approach combining multiple techniques will likely provide the most comprehensive structural information.

  • What controls are essential when studying the function of recombinant IML2 protein?

    Rigorous experimental design for IML2 studies should include these controls:

    • Expression controls:

      • Empty vector transfections/transformations

      • Unrelated membrane protein expressed under identical conditions

      • Wild-type IML2 as positive control for mutational studies

    • Purification controls:

      • Mock purification from cells not expressing IML2

      • Purification of a well-characterized protein using identical protocols

    • Functional controls:

      • Complementation with wild-type IML2 in knockout strains

      • Inactive mutants (identified through preliminary studies)

      • Temperature-sensitive variants if available

    • Interaction controls:

      • Competition with excess unlabeled protein

      • Use of scrambled peptides for peptide interaction studies

      • IgG or pre-immune serum controls for immunoprecipitation

    • Localization controls:

      • Co-staining with established mitochondrial markers

      • Fractionation quality controls (markers for different compartments)

    These controls address the experimental design principles outlined for rigorous research , including accounting for variables that might influence results and ensuring specificity of observed effects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.