Recombinant Yarrowia lipolytica NADH-ubiquinone oxidoreductase chain 3 (ND3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment based on availability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. To request a specific tag, please inform us; we will prioritize its development.
Synonyms
ND3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica)
Target Names
ND3
Target Protein Sequence
MNTFIIFIILIPIVGFALLAVNILLAVYKPYNEKLGAFECGLTSFNQTRLAFNAAFILVA ILFLPFDLEISTLLPYVMSIYLVSNYGFTIVLLFLLILIIGFVYEINTNALKINKHNKPN TDSLIYKL
Uniprot No.

Target Background

Function

Recombinant Yarrowia lipolytica NADH-ubiquinone oxidoreductase chain 3 (ND3): A core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is considered part of the minimal assembly necessary for catalytic activity. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone believed to be the immediate electron acceptor.

Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is the significance of Yarrowia lipolytica as a model organism for studying NADH-ubiquinone oxidoreductase (Complex I)?

Y. lipolytica serves as an excellent model organism for studying complex I due to several unique characteristics. As an obligate aerobic yeast, it possesses a respiratory chain containing complexes I-IV, an "alternative" NADH-dehydrogenase (NDH2), and a non-heme alternative oxidase (AOX). Unlike Saccharomyces cerevisiae, which lacks complex I, Y. lipolytica's respiratory system more closely resembles that of higher eukaryotes. Importantly, complex I is essential in Y. lipolytica because its NDH2's NADH binding site faces the mitochondrial intermembrane space rather than the matrix, making it a valuable model for complex I functional studies . Additionally, its genetic system has been well-developed, allowing for targeted manipulation of complex I subunits and detailed structure-function analyses. The yeast can grow under various environmental conditions, enabling researchers to study the effects of different stressors on mitochondrial function .

What genetic tools are available for manipulating the ND3 gene in Y. lipolytica?

Several genetic tools have been developed for manipulating ND3 and other complex I subunits in Y. lipolytica. These include:

  • Shuttle plasmids that can complement deleted complex I subunits

  • Site-directed mutagenesis systems for introducing specific mutations

  • Affinity tagging strategies (e.g., hexa-histidine tags) for protein purification

  • Deletion strain construction methods, including the ability to redirect NDH2 to the matrix side to compensate for complex I loss

  • Inducible promoter systems for controlled expression

These tools allow researchers to generate recombinant versions of ND3 with modified properties and study their effects on complex I assembly and function. The availability of these genetic systems makes Y. lipolytica particularly valuable for structure-function analyses of complex I components.

What growth conditions are optimal for expressing recombinant ND3 in Y. lipolytica?

Optimal growth conditions for expressing recombinant proteins in Y. lipolytica, including ND3, include:

ParameterOptimal RangeNotes
pH5.0-5.5Growth efficiency drops to ~75% at pH 3 or pH 7
Temperature28-30°CStrain-dependent variations exist
Oxygen availabilityHigh (kLa ~110 h⁻¹)Critical for respiratory function and protein expression
Carbon sourceOleic acid or glucoseLipid-metabolizing capability can be advantageous
Growth phaseLate exponentialBalances biomass accumulation with protein expression

Oxygen availability is particularly critical for Y. lipolytica as an obligate aerobic organism, with higher oxygenation levels (kLa of 110 h⁻¹ vs. 28 h⁻¹) significantly improving recombinant protein production . The strain's robustness allows it to adapt to a wide range of conditions, though optimal protein expression typically requires more controlled parameters.

How can site-directed mutagenesis of ND3 be optimized to identify functionally critical residues in complex I?

Site-directed mutagenesis of ND3 requires a strategic approach to identify functionally critical residues. Start by selecting highly conserved amino acids across species using multiple sequence alignments. Focus on:

  • Residues within predicted proton translocation pathways

  • Amino acids at interfaces with other complex I subunits

  • Regions implicated in quinone binding

  • Conserved charged residues that may participate in proton pumping

The established genetic tools for Y. lipolytica allow for precise mutagenesis of these targets . After generating mutants, employ a hierarchical characterization approach:

Analysis LevelTechniquesInformation Obtained
Growth phenotypingAerobic growth curves, spot testsInitial assessment of mutation impact
Complex I assemblyBlue native PAGE, Western blottingEffects on protein complex formation
Enzymatic activitySpectrophotometric assays (NADH:ubiquinone oxidoreductase activity)Quantitative functional impact
Proton pumpingInverted membrane vesicles, pH indicatorsEffects on bioenergetic coupling
Structural analysisCryo-EM or X-ray crystallography of purified complexesStructural perturbations

For optimal purification of mutant complexes, utilize the hexa-histidine tag approach on accessory subunits like NUGM (30 kDa), which allows for affinity chromatography purification while maintaining complex integrity . Remember that purified complex I typically requires phosphatidylcholine supplementation (400-500 molecules per complex) to restore full activity for in vitro analyses .

What are the challenges in expressing and purifying functional recombinant ND3 for structural studies?

Expressing and purifying functional recombinant ND3 presents several unique challenges:

  • Mitochondrial localization: As a mitochondrially-encoded protein, recombinant expression requires proper targeting to mitochondria, which often necessitates the addition of appropriate targeting sequences and consideration of codon optimization.

  • Membrane protein solubilization: ND3 is a highly hydrophobic membrane protein, requiring careful selection of detergents for extraction without compromising structure or function. The precise detergent-to-protein ratio is critical for maintaining native conformation.

  • Maintaining complex I integrity: ND3 functions as part of the larger complex I structure. Purification strategies must preserve interactions with other subunits if functional studies are the goal. When purifying the entire complex using tagged subunits like NUGM, activity loss occurs but can be restored with phosphatidylcholine supplementation (400-500 molecules per complex) .

  • Activity assessment: Purified complex I from Y. lipolytica loses most of its NADH:ubiquinone oxidoreductase activity during the purification process, necessitating reactivation protocols for functional studies .

  • Expression level optimization: Balancing expression levels to avoid overwhelming the cellular machinery while obtaining sufficient protein yield requires careful promoter selection and growth condition optimization.

A multifaceted approach combining genetic engineering, optimized growth conditions (particularly oxygen availability), and careful purification protocols is necessary to overcome these challenges.

How does the absence or mutation of ND3 affect respiratory chain assembly and function in Y. lipolytica?

The absence or mutation of ND3 in Y. lipolytica has profound effects on respiratory chain assembly and function:

  • Complex I assembly disruption: ND3 is critical for the structural integrity of complex I. Its absence typically results in the accumulation of subcomplexes and impaired assembly of the membrane arm of complex I.

  • Respiratory deficiency: Since complex I is essential in Y. lipolytica (unlike in S. cerevisiae), ND3 mutations often lead to severe respiratory deficiency unless compensatory mechanisms are engaged. This essentiality stems from the fact that NDH2's NADH binding site faces the intermembrane space rather than the matrix in Y. lipolytica .

  • Compensatory mechanisms: To study lethal ND3 mutations, researchers can generate viable strains by redirecting NDH2 to the matrix side using appropriate targeting sequences, allowing for NADH oxidation despite complex I deficiency .

  • Bioenergetic consequences: Mutations in ND3 typically affect proton pumping efficiency, reducing the proton motive force and ATP synthesis. The extent of this effect depends on the specific mutation and its location within functionally critical domains.

  • ROS production: Dysfunctional complex I due to ND3 mutations often leads to increased reactive oxygen species production, potentially triggering mitochondrial stress responses.

These effects can be quantitatively assessed through measurements of oxygen consumption, membrane potential, ATP synthesis rates, and superoxide production in intact cells or isolated mitochondria from mutant strains.

What is the relationship between ND3 expression, complex I activity, and lipid metabolism in Y. lipolytica?

The relationship between ND3 expression, complex I activity, and lipid metabolism in Y. lipolytica is intricate and bidirectional:

  • Energy supply for lipid metabolism: Functional complex I (including properly expressed ND3) is essential for efficient respiratory ATP generation, which powers lipid biosynthetic and catabolic pathways. In engineered Y. lipolytica strains with enhanced lipid utilization capabilities, adequate complex I function becomes even more critical to support rapid growth rates (up to 0.32 h⁻¹) and efficient substrate consumption .

  • Lipid composition effects on complex I: The phospholipid environment significantly impacts complex I function. Purified complex I from Y. lipolytica requires phosphatidylcholine supplementation (400-500 molecules per complex) to restore full NADH:ubiquinone oxidoreductase activity . This suggests that the lipid microenvironment is crucial for proper ND3 function within complex I.

  • Metabolic feedback loops: In engineered Y. lipolytica strains with enhanced lipid accumulation (e.g., through co-expression of DGA1 and SCD), the increased lipid content (up to 67.66% g/g DCW) impacts mitochondrial membrane composition, potentially altering complex I assembly and activity .

  • Acetyl-CoA availability: Enhanced β-oxidation through MFE2 overexpression increases acetyl-CoA pools (up to 82% higher than control strains) , which can affect both lipid metabolism and mitochondrial function through post-translational modifications of complex I subunits, including ND3.

This interrelationship makes Y. lipolytica particularly valuable for studying how mitochondrial energy metabolism interfaces with lipid homeostasis.

What purification strategies are most effective for isolating functional recombinant complex I containing ND3 from Y. lipolytica?

Effective purification of complex I containing ND3 from Y. lipolytica requires a multi-step approach:

  • Mitochondrial isolation: First, isolate intact mitochondria using differential centrifugation with osmotic stabilizers to preserve membrane integrity.

  • Membrane solubilization: Solubilize mitochondrial membranes using mild detergents like n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) at carefully optimized detergent-to-protein ratios.

  • Affinity chromatography: The most efficient purification method utilizes a hexa-histidine tag attached to an accessory subunit like NUGM (30 kDa), allowing for rapid one-step affinity purification while maintaining complex integrity . This approach yields complex I preparations of high purity suitable for structural and functional studies.

  • Activity preservation: The purified complex typically loses most of its NADH:ubiquinone oxidoreductase activity during isolation. Activity can be restored by adding 400-500 molecules of phosphatidylcholine per complex I . This reactivation step is crucial for functional analyses.

  • Quality assessment: Evaluate purified complex I by blue native PAGE for complex integrity, SDS-PAGE for subunit composition (including ND3), and spectrophotometric assays for NADH oxidation activity.

How can researchers optimize oxygen availability for maximum expression of recombinant complex I components in Y. lipolytica?

Optimizing oxygen availability for recombinant complex I expression in Y. lipolytica involves several strategic approaches:

  • Bioreactor design and operation:

    • Implement high kLa values (~110 h⁻¹) through appropriate impeller design and agitation rates

    • Use enhanced aeration systems with fine bubble diffusers

    • Consider oxygen-enriched air supplementation for high-density cultures

    • Monitor dissolved oxygen levels continuously and maintain above 30% saturation

  • Medium formulation:

    • Reduce medium viscosity to improve oxygen transfer

    • Include oxygen carriers or surfactants that enhance oxygen solubility

    • Balance carbon source concentration to prevent excessive oxygen demand

  • Culture parameters:

    • Optimize temperature (typically 28-30°C) to balance oxygen solubility with growth rate

    • Maintain pH at optimal levels (5.0-5.5) to support both growth and protein expression

    • Implement fed-batch strategies to control oxygen demand throughout cultivation

  • Genetic approaches:

    • Use oxygen-responsive promoters (such as POX2p or LIP2p) that are activated under appropriate oxygen conditions

    • Consider co-expression of stress response factors that enhance cellular adaptation to varying oxygen levels

The critical importance of oxygen availability stems from Y. lipolytica's obligate aerobic nature and the high respiratory demand for complex I expression and assembly. Experimental data shows that increasing kLa values from 28 h⁻¹ to 110 h⁻¹ significantly improves recombinant protein production in Y. lipolytica .

What analytical methods are most informative for characterizing ND3 mutations and their effects on complex I function?

A comprehensive analytical toolkit is necessary for thoroughly characterizing the effects of ND3 mutations on complex I function:

Analytical MethodParameters MeasuredTechnical Considerations
Spectrophotometric assaysNADH:ubiquinone oxidoreductase activity ratesRequires appropriate artificial electron acceptors (e.g., decylubiquinone)
Oxygen consumption measurementsIntegrated respiratory chain activityCan be performed with intact cells, isolated mitochondria, or purified complex I
Membrane potential assaysProton pumping efficiencyUtilizes fluorescent dyes (e.g., TMRM, JC-1) or potential-sensitive probes
EPR spectroscopyIron-sulfur cluster redox statesProvides insights into electron transfer within complex I
Protein-protein interaction analysesComplex I assembly stateUtilizes blue native PAGE, co-immunoprecipitation, or crosslinking approaches
Hydrogen/deuterium exchange mass spectrometryConformational dynamicsReveals subtle structural changes induced by mutations
Proteoliposome reconstitutionIsolated complex I activityAllows precise control of lipid environment and substrate accessibility
Cryo-electron microscopyStructural perturbationsCan visualize structural changes at near-atomic resolution
In silico molecular dynamics simulationsPredicted structural and functional effectsRequires high-quality structural models as starting points

For mutations affecting proton pumping, a particularly informative approach combines membrane potential measurements with simultaneous oxygen consumption analyses to calculate the H⁺/e⁻ stoichiometry. This provides direct insight into how specific ND3 mutations might decouple electron transfer from proton translocation . Additionally, site-directed mutagenesis has already proven valuable for identifying functionally important amino acids in Y. lipolytica complex I .

How can transcriptomic and proteomic approaches be integrated to better understand the effects of ND3 modifications on cellular metabolism?

Integrating transcriptomic and proteomic approaches provides a comprehensive understanding of how ND3 modifications affect cellular metabolism in Y. lipolytica:

  • Experimental design considerations:

    • Compare wild-type, ND3 mutant, and complemented strains under identical growth conditions

    • Sample at multiple time points to capture dynamic responses

    • Include both normal and stress conditions (e.g., oxidative stress, nutrient limitation)

    • Use biological replicates (minimum n=3) for statistical robustness

  • Transcriptomic profiling:

    • RNA-seq to identify differentially expressed genes

    • Targeted RT-qPCR for validation of key metabolic genes

    • Analysis of mitochondrial transcripts to assess retrograde signaling

    • Focus on genes involved in energy metabolism, redox homeostasis, and stress response

  • Proteomic analysis:

    • Quantitative proteomics using TMT or SILAC labeling

    • Phosphoproteomics to identify post-translational regulatory events

    • Specialized approaches for membrane protein analysis (relevant for respiratory complexes)

    • Protein-protein interaction studies using BioID or proximity labeling

  • Metabolic pathway mapping:

    • Integrate data using pathway enrichment tools specific for Y. lipolytica

    • Focus on acetyl-CoA metabolism, which is significantly affected by respiratory chain function and can increase up to 82% in engineered Y. lipolytica strains

    • Analyze lipid metabolism pathways, particularly in relation to complex I function and membrane composition

    • Map changes in ATP-generating and ATP-consuming processes

  • Validation approaches:

    • Metabolic flux analysis using 13C-labeled substrates

    • Direct measurement of key metabolites (e.g., acetyl-CoA, ATP/ADP ratio, NAD+/NADH)

    • In vivo respiratory measurements

    • Growth phenotyping under various carbon sources

This integrated approach can reveal how ND3 modifications propagate effects throughout cellular metabolism, particularly affecting the interrelationship between respiratory chain function and lipid metabolism that is characteristic of Y. lipolytica.

How might CRISPR-Cas9 technologies be applied to enhance ND3 manipulation in Y. lipolytica?

CRISPR-Cas9 technologies offer promising approaches to enhance ND3 manipulation in Y. lipolytica:

  • Mitochondrial genome editing: Although challenging due to mitochondrial compartmentalization, emerging technologies for delivering CRISPR components to mitochondria could enable direct editing of the mitochondrially-encoded ND3 gene. This would represent a significant advance over current methods that rely on complementation strategies.

  • Nuclear-encoded regulators: CRISPR-Cas9 can be used to systematically modify nuclear genes that regulate ND3 expression, assembly, or function, creating a comprehensive regulatory network map.

  • Multi-locus editing: Simultaneous modification of ND3 along with other complex I subunits could reveal epistatic interactions and cooperative functions that are difficult to detect with traditional single-gene approaches.

  • Base editing approaches: Precision base editors could introduce specific point mutations in ND3 without requiring double-strand breaks, potentially increasing editing efficiency in mitochondrial DNA.

  • Inducible expression systems: CRISPR interference (CRISPRi) or activation (CRISPRa) systems could be developed for Y. lipolytica to reversibly modulate ND3 expression, allowing for temporal studies of complex I assembly and function.

Implementation of these approaches would build upon existing genetic tools for Y. lipolytica while addressing current limitations in mitochondrial genome editing, potentially revolutionizing the study of complex I components like ND3.

What potential applications exist for engineered Y. lipolytica strains with modified ND3 in understanding human mitochondrial diseases?

Engineered Y. lipolytica strains with modified ND3 offer several promising applications for understanding human mitochondrial diseases:

  • Disease-associated mutation modeling: Y. lipolytica can serve as a platform for introducing and studying human ND3 mutations associated with mitochondrial disorders such as Leigh syndrome, MELAS, and other complex I deficiencies. The similar structure of complex I between Y. lipolytica and humans makes this yeast an excellent model system .

  • Drug screening platform: Modified strains can be used to screen for compounds that rescue complex I function in the presence of pathogenic mutations, potentially identifying therapeutic candidates for mitochondrial disorders.

  • Compensatory mechanism identification: By studying how Y. lipolytica adapts to ND3 mutations, researchers may discover compensatory mechanisms that could be therapeutically targeted in human patients. For example, the redirection of NDH2 to the matrix side in Y. lipolytica represents a compensatory strategy that maintains viability despite complex I deficiency .

  • Structural insights: The ability to purify mutant complex I from Y. lipolytica using affinity tags provides opportunities for structural studies that can reveal how disease-associated mutations disrupt complex I architecture and function.

  • Energy metabolism crosstalk: The relationship between complex I function and lipid metabolism in Y. lipolytica parallels similar connections in human cells, offering insights into how mitochondrial dysfunction impacts broader metabolic networks in disease states.

These applications leverage Y. lipolytica's unique position as an obligate aerobic yeast with a respiratory chain similar to that of humans, combined with robust genetic tools for precise manipulation of complex I components.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.