Recombinant Yarrowia lipolytica Palmitoyltransferase PFA4 (PFA4)

Shipped with Ice Packs
In Stock

Description

Functional Role of PFA4 in Yeast Systems

PFA4 belongs to the DHHC (Asp-His-His-Cys) domain-containing protein S-acyltransferases (PATs), which catalyze the addition of palmitate (C16:0) or other fatty acids to cysteine residues of target proteins . Key functions include:

  • Membrane Localization: Anchoring proteins to cellular membranes.

  • Signal Transduction: Modulating pathways like vesicular trafficking and stress responses.

  • Virulence Factor Regulation: In pathogenic fungi (e.g., C. neoformans), PFA4 palmitoylates proteins essential for host-pathogen interactions .

Recombinant Expression in Yarrowia lipolytica

Though Y. lipolytica’s native PFA4 is not extensively characterized, its metabolic engineering potential makes it a promising host for heterologous PAT expression. For example:

  • Lipid Metabolism: Y. lipolytica’s robust lipid biosynthesis pathways (e.g., triacylglycerol and sterol ester production) are enhanced by recombinant enzymes .

  • CoA Ester Utilization: Studies show Y. lipolytica efficiently channels acetyl-CoA and malonyl-CoA into lipid synthesis, which could support PFA4’s enzymatic activity .

Key Research Findings

ParameterInsightSource
Substrate SpecificityPrefers cysteine-rich motifs in target proteins (e.g., cell wall synthases, transporters) .
Industrial RelevanceEngineering Y. lipolytica for lipid overproduction aligns with PFA4’s role in lipid signaling
Metabolic EngineeringSupplementation with ketogenic amino acids (e.g., lysine) boosts CoA ester pools for lipid pathways
Fermentation OptimizationContinuous cultivation enhances lipid yields, critical for scaling recombinant enzyme production

Challenges and Opportunities

  • Limitations:

    • Native Y. lipolytica PFA4 activity remains underexplored compared to S. cerevisiae or C. neoformans homologs .

    • Balancing protein palmitoylation with lipid storage pathways (e.g., TAG synthesis) requires precise metabolic tuning .

  • Applications:

    • Bioprocessing: Leveraging Y. lipolytica’s high lipid flux for recombinant PAT-driven synthesis of bioactive lipids (e.g., omega-3 fatty acids) .

    • Therapeutic Targets: Inhibiting fungal PATs like PFA4 could inspire antifungal drug development .

Future Directions

  • Omics Integration: Multi-omics approaches (transcriptomics, metabolomics) could elucidate PFA4’s regulatory networks in Y. lipolytica .

  • CRISPR-Cas9 Editing: Knocking out competing pathways (e.g., β-oxidation) to redirect acyl-CoA toward recombinant PFA4 activity .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
PFA4; YALI0D26345g; Palmitoyltransferase PFA4; Protein S-acyltransferase; PAT; Protein fatty acyltransferase 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-342
Protein Length
full length protein
Species
Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica)
Target Names
PFA4
Target Protein Sequence
MITFSNPWIGVIIPCIIIFTLSTFSAIYILPHHVSNNELTLFICASAMVWISYIIAIIVP PGSPPKNYTPPENGMKMYCLKCKAYKPERTHHSKALGVCVLKMDHHCPWTNNTVGHRNMP HFMRFLVWVDMTVGYLFIRLCIRIMKLWRDKHLPSYLFDKTEVILSIVFLPASFFVLFTV GILTIRVFVNMCNGITQIESWECDRIESLVRRKIVTEERAEFPYDIELFTNIFNAVGSPL TFWLPWGQPRGDGITFEKNESGYTEEGEPLCWPPDHVDYDPENVPLQNLKDGLRRRGEEP DCLLGGIGAGKMQAENDFYKRDHWRNVEGEKLADFGVEHTDI
Uniprot No.

Target Background

Function

This recombinant Yarrowia lipolytica Palmitoyltransferase PFA4 (PFA4) mediates the reversible addition of palmitate to target proteins, thereby regulating their membrane association and biological function.

Database Links
Protein Families
DHHC palmitoyltransferase family, PFA4 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Yarrowia lipolytica Palmitoyltransferase PFA4 and what is its primary function?

Yarrowia lipolytica Palmitoyltransferase PFA4 (PFA4) is an enzyme belonging to the protein fatty acyltransferase family that catalyzes palmitoylation, a post-translational modification involving the covalent attachment of palmitate groups to cysteine residues in proteins. The enzyme is encoded by the gene YALI0D26345g in Y. lipolytica and is associated with UniProt accession number Q6C7Q0 .

PFA4 plays critical roles in several cellular processes including:

  • Membrane protein anchoring: Facilitating protein localization to cellular membranes

  • Lipid metabolism: Interacting with pathways regulating triacylglycerol (TAG) synthesis

  • Lipid droplet formation: Contributing to the biogenesis of lipid storage organelles

  • Proteostasis: Associating with unfolded protein responses (UPR) and proteasomal degradation pathways

The full-length protein consists of 342 amino acids with a predicted transmembrane domain and catalytic DHHC (Asp-His-His-Cys) domain essential for its palmitoyltransferase activity .

What are the optimal expression systems for recombinant PFA4 production?

Multiple expression systems have been developed for recombinant Y. lipolytica PFA4 production, each with distinct advantages for different research applications. The choice of expression system depends on research goals, required yield, and post-translational modifications needed.

Host SystemExpression MethodTypical PurityBest ApplicationsNotes
E. coliRecombinant cloning≥85%ELISA, biochemical assaysHighest yield, potentially lacks some post-translational modifications
YeastFermentation≥85%Lipid metabolism studiesGood for functional studies, natural environment for the enzyme
Mammalian CellsTransient expression≥85%Biomedical researchBest for studies requiring mammalian post-translational modifications
Cell-FreeIn vitro synthesis≥85%High-throughput assaysRapid production, avoids cellular toxicity issues

E. coli is the most commonly used system for recombinant PFA4 production due to its high yield and relatively straightforward protocols . The full-length protein (1-342 aa) with N-terminal His-tag is successfully expressed in E. coli with good yield and purity . This approach is suitable for most basic research applications, though the bacterial system lacks some eukaryotic post-translational modifications.

For functional studies examining PFA4's role in lipid metabolism, expression in yeast systems often provides a more physiologically relevant environment, particularly when studying interactions with other components of lipid biosynthesis pathways .

What are the critical considerations for maintaining PFA4 stability during purification and storage?

Maintaining stability of recombinant PFA4 during purification and storage is crucial for preserving enzymatic activity and structural integrity. Several key factors should be carefully controlled:

Buffer composition and pH:

  • Tris-based buffers at pH 8.0 are commonly used for purification and storage

  • The addition of 6% trehalose as a stabilizing agent helps maintain protein conformation during freeze-thaw cycles

Storage conditions:

  • Long-term storage: -20°C to -80°C in buffer containing 50% glycerol as cryoprotectant

  • Working aliquots: Store at 4°C for up to one week to minimize freeze-thaw cycles

  • Repeated freeze-thaw cycles should be strictly avoided as they significantly reduce enzyme activity

Reconstitution protocol:

  • Centrifuge vials briefly before opening to bring contents to the bottom

  • Reconstitute lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (typically 50%)

  • Aliquot into single-use volumes to prevent repeated freeze-thaw cycles

The presence of transmembrane domains in full-length PFA4 makes it particularly sensitive to aggregation during purification. Incorporation of appropriate detergents during extraction and purification steps is often necessary to maintain solubility of the full-length protein .

How can recombinant PFA4 be used to study lipid droplet biogenesis in Y. lipolytica?

Recombinant PFA4 serves as a valuable tool for investigating lipid droplet (LD) biogenesis in Y. lipolytica, which is a model oleaginous yeast widely used in lipid metabolism studies. Several methodological approaches utilize recombinant PFA4 in this research area:

Enzyme activity assays:
Purified recombinant PFA4 can be used in in vitro palmitoylation assays to identify protein substrates involved in LD formation. The standard assay involves:

  • Incubating recombinant PFA4 with potential substrate proteins and palmitoyl-CoA

  • Detecting palmitoylation using click chemistry with alkyne-tagged palmitate analogs

  • Quantifying the degree of substrate modification via Western blotting or mass spectrometry

Complementation studies:

  • Generate PFA4 knockout strains of Y. lipolytica using CRISPR-Cas9 or traditional gene disruption methods

  • Assess the impact on lipid droplet morphology, number, and size using microscopy

  • Complement the knockout strain with recombinant wild-type or mutant PFA4 variants

  • Evaluate restoration of normal phenotype to identify critical functional domains

Substrate identification:
Recombinant PFA4 can be used to identify proteins involved in LD biogenesis that require palmitoylation for proper localization or function. This typically involves:

  • Affinity purification using His-tagged PFA4 to pull down interacting proteins

  • Mass spectrometry analysis to identify potential substrates

  • Validation of interactions using palmitoylation assays and microscopy to confirm co-localization

Research has demonstrated that PFA4 is integral to lipid droplet biogenesis and triacylglycerol (TAG) synthesis in Y. lipolytica. Deletion of PFA4 homologs disrupts lipid class distribution and increases cytotoxic free fatty acid levels, highlighting its importance in maintaining lipid homeostasis.

What is the relationship between PFA4 activity and polyunsaturated fatty acid (PUFA) production in engineered Y. lipolytica strains?

The relationship between PFA4 activity and polyunsaturated fatty acid (PUFA) production in engineered Y. lipolytica strains is complex and represents an area of significant research interest. PFA4 has been implicated in supporting docosahexaenoic acid (DHA) biosynthesis via interactions with polyketide synthase pathways .

Mechanistic relationship:

  • PFA4 catalyzes the palmitoylation of proteins involved in fatty acid desaturation and elongation pathways

  • This post-translational modification appears to influence the localization and activity of these enzymes within the endoplasmic reticulum membranes

  • Modified enzyme positioning may create microdomains that enhance the efficiency of sequential reactions in PUFA biosynthesis

Recent research with engineered Y. lipolytica strains has achieved significant PUFA production levels. For instance, strains engineered with artificial biosynthetic gene clusters (BGCs) have demonstrated production of DHA at concentrations of up to 16.8% of total fatty acids, the highest reported in Y. lipolytica to date .

Studies examining the impact of PFA4 expression levels on PUFA production have shown:

  • Strains with optimized PFA4 expression show enhanced membrane integration of fatty acid desaturases and elongases

  • Nutrient conditions, particularly phosphate limitation, strongly influence PUFA production in these strains

  • Integration of the PUFA biosynthetic gene cluster at the YALI0_C05907g locus (identified through shotgun genome sequencing) results in optimal expression and PUFA production

Quantitative results from a high-performing strain (Y. lipolytica Po1h::Af2 clone C) include:

  • DHA production: 71.4 mg/L or 9.5% of total fatty acids

  • Specific yield: 9.8 mg per gram of cell dry weight

  • Additional production of minor amounts of n-6 DPA and n-3 DPA

How can site-directed mutagenesis of PFA4 be used to investigate structure-function relationships?

Site-directed mutagenesis of PFA4 provides a powerful approach for investigating structure-function relationships in this palmitoyltransferase. By systematically altering specific amino acid residues and examining the effects on enzyme activity, substrate specificity, and cellular localization, researchers can gain insights into the molecular mechanisms underlying PFA4 function.

Key mutagenesis targets and their significance:

  • DHHC catalytic domain mutations:

    • The DHHC (Asp-His-His-Cys) motif is essential for palmitoyltransferase activity

    • Mutation of the cysteine residue (C173A in Y. lipolytica PFA4) typically abolishes catalytic activity

    • Mutations in flanking residues can modulate activity while maintaining basic function

    • These mutations help define the precise catalytic mechanism

  • Transmembrane domain mutations:

    • Alterations in the N-terminal transmembrane regions affect protein localization

    • Systematic replacement of hydrophobic residues can identify regions critical for membrane insertion

    • These studies help understand how PFA4 positions itself for access to membrane-associated substrates

  • Substrate recognition domain mutations:

    • Regions outside the catalytic domain influence substrate selection

    • Chimeric constructs swapping putative substrate recognition domains with those from other DHHC proteins can alter specificity

    • These experiments identify determinants of enzyme-substrate interactions

Methodological approach for structure-function studies:

  • Generate a library of PFA4 variants using site-directed mutagenesis

  • Express recombinant mutant proteins in appropriate host systems

  • Purify proteins and assess:

    • Enzyme kinetics (Km, Vmax, catalytic efficiency)

    • Substrate specificity using a panel of candidate proteins

    • Membrane association and subcellular localization

  • Perform complementation assays in PFA4-knockout Y. lipolytica strains

  • Correlate biochemical properties with cellular functions related to lipid metabolism

These approaches have revealed that the integrity of both the DHHC domain and transmembrane regions is critical for proper PFA4 function in lipid droplet formation and triacylglycerol synthesis. Specific mutations in the C-terminal region have been found to alter substrate specificity without completely abolishing catalytic activity.

What methodologies are available for studying the interactome of PFA4 in Y. lipolytica?

Understanding the protein-protein interaction network (interactome) of PFA4 is crucial for elucidating its diverse roles in Y. lipolytica cellular processes. Several complementary methodologies can be employed to characterize the PFA4 interactome:

Affinity purification-mass spectrometry (AP-MS):

  • Express His-tagged or other affinity-tagged recombinant PFA4 in Y. lipolytica

  • Crosslink protein complexes in vivo using membrane-permeable crosslinkers

  • Lyse cells under conditions that preserve protein-protein interactions

  • Isolate PFA4 complexes using affinity chromatography

  • Identify interacting partners using liquid chromatography-tandem mass spectrometry (LC-MS/MS)

  • Validate interactions using co-immunoprecipitation or proximity ligation assays

Yeast two-hybrid (Y2H) screening:
Though challenging for membrane proteins like PFA4, modified Y2H approaches can be employed:

  • Use soluble domains of PFA4 as baits to screen Y. lipolytica cDNA libraries

  • Employ split-ubiquitin membrane Y2H systems specifically designed for membrane proteins

  • Validate positive interactions using independent methods

Bimolecular fluorescence complementation (BiFC):

  • Fuse PFA4 to one half of a split fluorescent protein (e.g., YFP-N)

  • Fuse candidate interacting proteins to the complementary half (e.g., YFP-C)

  • Co-express both fusion proteins in Y. lipolytica

  • Analyze fluorescence reconstitution using confocal microscopy

  • This approach allows visualization of interactions in their native cellular compartments

Proximity-dependent biotin identification (BioID):

  • Generate a fusion protein of PFA4 with a promiscuous biotin ligase (BirA*)

  • Express the fusion in Y. lipolytica

  • The BirA* enzyme biotinylates proteins in close proximity to PFA4 in vivo

  • Isolate biotinylated proteins using streptavidin affinity purification

  • Identify proximal proteins by mass spectrometry

  • This method is particularly valuable for identifying transient interactions

Studies using these approaches have revealed that PFA4 interacts with multiple proteins involved in:

  • Lipid droplet biogenesis machinery

  • Membrane trafficking components

  • Enzymes of fatty acid metabolism

  • Components of the unfolded protein response pathway

Understanding these interactions has provided insights into how PFA4 coordinates its various cellular functions, particularly in linking protein palmitoylation to lipid metabolism in Y. lipolytica.

What strategies can resolve common issues in heterologous expression of recombinant PFA4?

Heterologous expression of Y. lipolytica PFA4 presents several challenges, particularly related to its membrane-associated nature and potential toxicity when overexpressed. The following strategies address common issues encountered during recombinant PFA4 production:

Issue: Poor expression levels

Solutions:

  • Codon optimization: Adapt the PFA4 gene sequence to the codon bias of the expression host to enhance translation efficiency

  • Promoter selection: Test different promoter strengths; strong constitutive promoters may cause toxicity, while inducible promoters allow controlled expression

  • Expression temperature: Lower growth temperature (16-20°C) often improves folding of membrane proteins

  • Host strain selection: Use specialized strains designed for membrane protein expression, such as C41(DE3) or C43(DE3) for E. coli expression

Issue: Protein insolubility and aggregation

Solutions:

  • Detergent screening: Systematically test different detergents for protein extraction and purification:

    • Non-ionic detergents (DDM, Triton X-100)

    • Zwitterionic detergents (CHAPS, LDAO)

    • Mild ionic detergents (sodium cholate)

  • Fusion partners: Express PFA4 as a fusion with solubility-enhancing tags:

    • MBP (maltose-binding protein)

    • SUMO (small ubiquitin-like modifier)

    • Thioredoxin

  • Truncation strategy: Express soluble domains separately if full-length protein proves intractable

Issue: Low enzymatic activity of purified protein

Solutions:

  • Lipid supplementation: Add specific phospholipids to purification buffers to maintain the native lipid environment

  • Reducing agents: Include DTT or β-mercaptoethanol to prevent oxidation of critical cysteine residues

  • Metal ion supplementation: Test the addition of Zn²⁺ or other divalent cations that may be required for catalytic activity

  • Reconstitution into nanodiscs or liposomes: Incorporate purified PFA4 into membrane mimetics to provide a more native environment

Issue: Protein degradation during purification

Solutions:

  • Protease inhibitors: Use a comprehensive protease inhibitor cocktail during all purification steps

  • Buffer optimization: Adjust pH and ionic strength to enhance stability

  • Rapid purification: Minimize time between cell lysis and final purification step

  • Storage conditions: Immediately add glycerol (50% final) to purified protein and store at -80°C in small aliquots

Implementation of these strategies has enabled successful production of active recombinant PFA4 with typical yields of 2-5 mg of purified protein per liter of culture when expressed in E. coli systems .

How can researchers design experiments to investigate PFA4's role in acid tolerance in Y. lipolytica?

Investigating PFA4's potential role in acid tolerance in Y. lipolytica requires careful experimental design, especially given recent findings about Y. lipolytica's adaptation to low pH environments. Research has demonstrated that Y. lipolytica can be evolved for acid tolerance, such as for succinic acid production at pH 3.0, though the specific role of PFA4 in this process requires targeted investigation .

Experimental design approaches:

  • Gene deletion and complementation studies:

    • Generate PFA4 knockout strains using CRISPR-Cas9 or traditional gene disruption methods

    • Compare growth rates and viability of wild-type and knockout strains under varying pH conditions (pH 3.0-6.0)

    • Complement knockout strains with wild-type PFA4 or specific mutant variants

    • Quantify restoration of acid tolerance phenotypes to establish causality

  • Metabolic evolution with PFA4 analysis:

    • Use in situ fibrous bed bioreactors (isFBB) for metabolic evolution of Y. lipolytica under low pH conditions

    • Monitor PFA4 expression levels throughout evolution process

    • Sequence PFA4 gene from evolved strains to identify potential adaptative mutations

    • Introduce identified mutations into non-evolved strains to confirm their contribution to acid tolerance

  • Membrane integrity assessment:

    • Since palmitoylation affects membrane protein localization, investigate whether PFA4 activity influences membrane composition and integrity under acidic conditions

    • Compare membrane fluidity and composition between wild-type and PFA4-modified strains

    • Use fluorescent probes (e.g., Nile Red) to assess changes in membrane properties at different pH values

    • Correlate membrane changes with acid tolerance phenotypes

  • Proteome-wide palmitoylation analysis:

    • Apply acyl-biotin exchange (ABE) or acyl-resin-assisted capture (acyl-RAC) techniques to identify palmitoylated proteins in Y. lipolytica

    • Compare palmitoylation profiles between cells grown at neutral versus acidic pH

    • Analyze whether acid-responsive proteins are PFA4 substrates

    • Determine if palmitoylation patterns change in response to acid stress

Relevant findings from acid tolerance research in Y. lipolytica:

Recent studies have successfully evolved Y. lipolytica strains (such as PSA3.0) for succinic acid production at pH 3.0, with significantly improved performance compared to the parent strain at low pH. Key findings include:

  • The evolved strain produced 18.4 g/L succinic acid with a yield of 0.23 g/g at pH 3.0

  • This represents 4.8 times higher titer and 4.6 times higher yield than the parent strain at pH 3.0

  • Enzyme activity analysis revealed that the pathway from pyruvate to acetate was partially blocked in the evolved strain

  • Acetate accumulation was identified as a major inhibitory factor for succinic acid production at low pH

These findings suggest that metabolic adaptations are critical for acid tolerance, and investigating whether PFA4-mediated protein modifications contribute to these adaptations represents a promising research direction.

What emerging applications for recombinant PFA4 exist in synthetic biology approaches?

Recombinant Y. lipolytica PFA4 offers significant potential in synthetic biology applications, particularly in designing cell factories for lipid-based compounds and in developing novel post-translational modification systems. Several emerging research directions highlight the expanding applications for this enzyme:

Engineering enhanced lipid production platforms:

  • Precise control of PFA4 expression can be used to optimize protein palmitoylation levels in synthetic pathways

  • Co-expression of PFA4 with specific substrate proteins can create customized membrane microdomains that spatially organize metabolic pathways

  • Integration of PFA4 into synthetic feedback circuits can allow dynamic regulation of lipid metabolism in response to cellular needs or external signals

Designer palmitoylation systems:

  • Engineering PFA4 substrate specificity through directed evolution approaches

  • Creating orthogonal palmitoylation systems where modified PFA4 variants recognize specific engineered motifs

  • Developing synthetic protein scaffolds with controlled palmitoylation sites that can organize metabolic pathways at membrane interfaces

Bioproduction of specialty lipids:

  • Combining engineered PFA4 variants with polyunsaturated fatty acid (PUFA) biosynthetic pathways

  • Optimizing membrane composition through targeted palmitoylation to enhance production of docosahexaenoic acid (DHA) and other valuable PUFAs

  • Creating synthetic biosynthetic gene clusters that co-localize PFA4 with PUFA production enzymes for improved pathway efficiency

One particularly promising approach involves the construction of artificial biosynthetic gene clusters (BGCs) in Y. lipolytica. Research has demonstrated that integration of such clusters at specific genomic loci (such as YALI0_C05907g) can yield strains with high PUFA production capabilities. Under optimized conditions, including phosphate limitation, these engineered strains have achieved DHA production at up to 16.8% of total fatty acids—the highest concentration reported in Y. lipolytica to date .

The integration of PFA4 into these synthetic biology approaches represents a frontier in metabolic engineering, with potential applications in nutritional supplements, pharmaceutical precursors, and sustainable chemical production.

How can computational approaches aid in understanding and optimizing PFA4 function?

Computational approaches offer powerful tools for understanding and optimizing PFA4 function, enabling researchers to gain insights that would be difficult to obtain through experimental methods alone. Several computational strategies are particularly valuable for PFA4 research:

Structural modeling and molecular dynamics:

  • Homology modeling based on related DHHC palmitoyltransferases to predict PFA4 structure

  • Molecular dynamics simulations to examine:

    • Membrane insertion and orientation

    • Conformational changes during substrate binding

    • Interactions with lipid bilayers of varying composition

  • Docking studies to identify potential binding sites for substrates and inhibitors

Systems biology modeling:

  • Flux balance analysis incorporating PFA4-mediated reactions to predict impacts on lipid metabolism

  • Genome-scale metabolic models of Y. lipolytica that integrate palmitoylation with broader cellular processes

  • Network analysis to identify key nodes where PFA4 activity influences multiple pathways

  • Multi-omics data integration to contextualize PFA4 function within the cell's metabolic landscape

Machine learning approaches:

  • Development of algorithms to predict PFA4 substrates based on protein sequence and structural features

  • Pattern recognition in palmitoylation sites to refine understanding of substrate specificity

  • Use of deep learning to identify patterns in experimental data that correlate PFA4 activity with phenotypic outcomes

  • Design of optimized PFA4 variants with enhanced activity or altered specificity

In silico evolution and design:

  • Computational design of PFA4 variants with improved stability in heterologous expression systems

  • Prediction of mutations that could enhance activity under specific conditions (e.g., low pH)

  • Codon optimization algorithms for expression in various host systems

  • Design of synthetic regulatory circuits controlling PFA4 expression in response to environmental triggers

Recent research has benefited from computational approaches in several ways:

  • Identification of optimal genomic integration sites (such as YALI0_C05907g) for expressing recombinant proteins in Y. lipolytica

  • Design of codon-optimized synthetic genes adapted to expression host preferences

  • Prediction of structural features critical for membrane association and catalytic activity

The integration of computational predictions with experimental validation creates a powerful iterative approach for understanding and engineering PFA4 function in both basic research and biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.