Recombinant Yarrowia lipolytica Palmitoyltransferase SWF1 (SWF1)

Shipped with Ice Packs
In Stock

Description

Production and Purification

SWF1 is produced recombinantly in Y. lipolytica strains optimized for high-yield protein expression. Key steps include:

  • Vector Design: Integration of the SWF1 gene under strong promoters (e.g., LIP2 or ICL1) for constitutive expression .

  • Fermentation: Cultivation in lipid-rich media to induce enzyme production, leveraging Y. lipolytica’s native lipid metabolism .

  • Purification: Affinity chromatography using tags (e.g., His-tag) followed by buffer exchange into glycerol-containing storage solutions .

Functional Role in Lipid Metabolism

SWF1 catalyzes the transfer of palmitate groups to cysteine residues of target proteins, influencing:

  • Lipid Droplet Formation: Critical for triacylglycerol (TAG) synthesis and lipid storage in Y. lipolytica .

  • Membrane Protein Localization: Facilitates anchoring of peripheral membrane proteins, enhancing metabolic flux in engineered strains .

  • Stress Response: Linked to proteostasis, as lipid metabolism modulates unfolded protein response pathways .

Studies on Y. lipolytica mutants lacking SWF1 homologs (e.g., DGA1, DGA2) reveal impaired lipid accumulation and growth defects, underscoring its metabolic indispensability .

Metabolic Engineering

  • Lipid Overproduction: SWF1 supports strain engineering for enhanced lipid yields (e.g., 67.66% lipid content in strain yDTY214) .

  • Terpenoid Biosynthesis: Synergizes with acetyl-CoA carboxylase (ACC1) to boost precursor availability for carotenoids like β-carotene .

Industrial Enzyme Production

  • Secretory Pathways: Y. lipolytica’s efficient secretion machinery enables SWF1’s use in co-expression systems for complex enzymes (e.g., cytochrome P450s) .

  • Scale-Up Feasibility: Demonstrated in 50L–18m³ bioreactors, achieving commercial-grade yields .

Research Gaps and Future Directions

  • Mechanistic Insights: Structural studies are needed to resolve SWF1’s substrate specificity and regulatory interactions.

  • Strain Optimization: CRISPR-Cas9 editing could further enhance SWF1 expression in high-lipid chassis strains .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
SWF1; YALI0B01606g; Palmitoyltransferase SWF1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-381
Protein Length
full length protein
Species
Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica)
Target Names
SWF1
Target Protein Sequence
MWLKIYLLSILAISVFTFVFLFGALPQFEDTAVWKFRKWLSNRPAAIRSWDSKYCGGRLS VVGDFCGSVVAPAAPWSVPILYCAFTTYMFSAYYEDLHPFIAENHWYYAWLAPVAYTILV VSFVLATFSDPGKITKQNHALLLNQFRFDNLMFLEDTECSTCKFTKPARSKHDRFTNKCV AKFDHYCLWINNTVGLYNYRWFLFFLLGNVWTLCWGALLAGLKMIVMVAAEYKDHPKPLP SIFSQWWQVMITNENKRVGIIFLLSVSTGALACAFTAMHFYYIYLGATTNETDKWGDIHA AISEGSVWMFQKPGFKLDRSILLQKDEEGRPNRSLTAEEREYVAQNGLALTLLTDHKPIV NIYDKGFLNNLKAVMFPNSAY
Uniprot No.

Target Background

Function
Palmitoyltransferase that targets several endosomal SNAREs. It palmitoylates SNAREs at cysteine residues near the cytoplasmic end of their transmembrane domain. This enzyme may play a role in the cellular quality control of transmembrane domain-containing proteins.
Gene References Into Functions
  1. The Yarrowia lipolytica Swf1 orthologue lacking one of the zinc-binding pockets is able to complement a yeast swf1 knockout strain. PMID: 23790227
Database Links
Protein Families
DHHC palmitoyltransferase family, SWF1 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is SWF1 and what is its primary function in cellular processes?

SWF1 (Spore Wall Formation 1) is a member of the DHHC-CDR family of palmitoyltransferases that catalyzes the addition of palmitate to cysteine residues in target proteins . In yeast systems, SWF1 is responsible for modifying SNAREs (soluble N-ethylmaleimide-sensitive factor attachment protein receptors) including Snc1, Syn8, and Tlg1 through palmitoylation, which can be detected through changes in electrophoretic mobility on polyacrylamide gels . This post-translational modification significantly impacts protein function by affecting membrane association, localization, and stability of the target proteins within cellular compartments. The principal role of SWF1 appears to be protecting specific membrane proteins from degradation pathways, as evidenced by the finding that palmitoylation by SWF1 prevents the degradation of the SNARE protein Tlg1 via the Tul1-dependent degradation pathway . Additionally, SWF1 is predominantly localized to the endoplasmic reticulum (ER), positioning it to modify newly synthesized proteins before they exit this organelle .

How does the molecular structure of SWF1 relate to its enzymatic activity?

While the search results don't provide specific structural details about SWF1 from Yarrowia lipolytica, insights can be drawn from related research on DHHC-CDR family proteins. SWF1 contains the characteristic DHHC (Asp-His-His-Cys) motif within a cysteine-rich domain that is essential for its palmitoyltransferase activity . The enzyme likely forms a palmitoyl-enzyme intermediate during the catalytic cycle before transferring the palmitate to substrate proteins. Palmitoylation catalyzed by SWF1 specifically targets cysteine residues located near or within transmembrane domains of SNARE proteins, suggesting a structural recognition mechanism for its substrates . The membrane topology of SWF1 is crucial for its function, as it must be positioned to access both the palmitoyl-CoA donor and the cysteine residues of target membrane proteins. The structural requirements for substrate recognition appear to be relatively specific, as evidenced by the fact that SWF1 selectively modifies only certain SNARE proteins among the seven DHHC-CDR family members tested .

What is the relationship between Yarrowia lipolytica metabolism and SWF1 function?

Yarrowia lipolytica is known for its ability to metabolize glucose and accumulate lipids intracellularly, making it an organism of interest for biotechnological applications . While the direct relationship between Y. lipolytica metabolism and SWF1 function is not explicitly detailed in the search results, we can draw some connections based on related research. In yeast systems, palmitoyltransferases like SWF1 play crucial roles in protein stability and trafficking, which indirectly affect metabolic processes . The search results indicate that disruption of genes involved in protein modification pathways can significantly impact cellular metabolism in Y. lipolytica, as demonstrated by the finding that knockout of the Snf1 gene (distinct from Swf1) leads to increased lipid accumulation and protein production . By extension, SWF1-mediated palmitoylation may influence metabolic regulation in Y. lipolytica by affecting the stability and function of proteins involved in cellular transport and signaling. The rewiring of cellular metabolism observed with Snf1 disruption suggests that protein modification systems like palmitoylation could be important targets for metabolic engineering of Y. lipolytica .

What are the molecular mechanisms of SWF1-mediated palmitoylation and substrate recognition?

The molecular mechanisms of SWF1-mediated palmitoylation involve a highly specific enzymatic process that targets cysteine residues in substrate proteins . SWF1 catalyzes the formation of a thioester bond between palmitate and the sulfhydryl group of cysteine residues, a modification that is sensitive to hydroxylamine treatment which cleaves these thioester bonds . Substrate recognition by SWF1 appears to depend on specific structural features, as it selectively modifies SNAREs like Snc1, Syn8, and Tlg1, but not all membrane proteins . The importance of the specific cysteine residues in substrate proteins is demonstrated by experiments showing that replacing these cysteines with serine or leucine residues abolishes the palmitoylation effect . Interestingly, the SWF1-mediated palmitoylation likely occurs in the ER, as fluorescence microscopy of GFP-tagged and HA-tagged SWF1 shows localization primarily to the ER and nuclear envelope . The enzyme's ability to distinguish between potential substrate proteins suggests a complex interaction between the palmitoyltransferase active site and specific structural features of the target proteins beyond simply recognizing exposed cysteine residues.

How do experimental conditions affect recombinant SWF1 expression and activity?

While the search results don't specifically address recombinant SWF1 from Y. lipolytica, insights can be drawn from related recombinant protein expression studies. Successful expression of recombinant enzymes often requires careful optimization of expression systems, vector design, and purification methods . For instance, the expression of sulfatase genes swf1 and swf4 (though unrelated to the palmitoyltransferase SWF1) utilized C-terminal His-tags for purification and detection, with gene-specific primers designed for optimal amplification . The vector choice, promoter strength, and codon optimization are critical factors that would affect recombinant SWF1 expression levels and activity. Temperature, pH, and buffer composition significantly impact enzyme activity, as demonstrated by the detailed pH optimization studies performed for sulfatases . When expressing SWF1 recombinantly, researchers might consider using affinity tags similar to those employed for other enzymes, while confirming that these modifications don't impair enzyme function, as was verified for HA-tagged and GFP-tagged versions of Swf1 in yeast studies . Additionally, expression in homologous versus heterologous systems may yield proteins with different post-translational modifications, potentially affecting activity and substrate specificity.

What are the consequences of SWF1 disruption on cellular physiology and protein homeostasis?

Disruption of SWF1 has profound effects on cellular physiology and protein homeostasis, particularly affecting SNARE proteins involved in membrane trafficking . In swf1Δ mutants, unpalmitoylated Tlg1 becomes susceptible to degradation via the Tul1-dependent pathway, resulting in reduced protein levels and potentially compromised endosomal fusion events . The electrophoretic mobility of Snc1 and Syn8 is altered in swf1Δ strains, indicating a lack of palmitoylation, though the functional consequences appear to vary between substrates . Beyond effects on specific substrates, swf1Δ mutants exhibit broader phenotypes including an inability to grow on lactate as a carbon source, suggesting impairment of metabolic pathways . Interestingly, the slightly reduced levels of Snc1 observed in swf1Δ mutants may result from indirect effects caused by the loss of Swf1-dependent modification of other substrates, highlighting the complex interconnectedness of cellular processes affected by SWF1 activity . These findings collectively demonstrate that SWF1-mediated palmitoylation contributes to proteostasis by protecting specific membrane proteins from degradation and influences broader aspects of cellular physiology including metabolism and membrane trafficking.

How does SWF1 compare to other palmitoyltransferases in terms of substrate specificity?

SWF1 displays distinctive substrate specificity compared to other palmitoyltransferases of the DHHC-CDR family, as demonstrated by systematic analysis of SNARE protein modification . When examining the palmitoylation of Snc1 across mutants lacking each of the seven yeast DHHC-CDR family members, only the swf1Δ strain showed altered electrophoretic mobility of Snc1, indicating that SWF1 is the sole palmitoyltransferase responsible for this modification . Similarly, analysis of Syn8 modification revealed that among all DHHC-CDR family members, only SWF1 contributes to its palmitoylation . This high degree of substrate specificity suggests that SWF1 recognizes unique structural features in its target proteins that other palmitoyltransferases do not recognize. The specificity extends to cysteine residues in particular protein contexts, as evidenced by the targeted modification of cysteines in transmembrane or membrane-proximal regions of SNARE proteins . The non-redundant nature of SWF1 function indicates that different palmitoyltransferases have evolved to modify distinct subsets of the proteome, potentially allowing for independent regulation of different cellular processes through selective protein palmitoylation.

What expression systems are optimal for producing recombinant SWF1?

The selection of an appropriate expression system for recombinant SWF1 production requires careful consideration of several factors to ensure proper folding, post-translational modifications, and enzyme activity. While the search results don't specifically address SWF1 expression systems, insights can be drawn from related enzyme expression studies . For membrane proteins like palmitoyltransferases, eukaryotic expression systems such as yeast or insect cells may be advantageous over bacterial systems due to their capacity for proper membrane protein folding and processing. Vector design should include appropriate promoters (constitutive or inducible depending on potential toxicity), signal sequences for proper localization, and affinity tags for purification, similar to the C-terminal His-tag approach used for sulfatases . When expressing SWF1 from Y. lipolytica in heterologous systems, codon optimization may be necessary to match the codon usage preferences of the expression host. The functionality of tagged recombinant SWF1 should be verified using activity assays, as was done for HA-tagged and GFP-tagged versions of Swf1 by confirming their ability to prevent degradation of GFP-Tlg1 . Additionally, expression conditions including temperature, induction time, and media composition should be optimized to maximize yield while maintaining protein quality.

What analytical methods can be used to detect and quantify SWF1-mediated palmitoylation?

Multiple analytical approaches can be employed to detect and quantify SWF1-mediated palmitoylation, each with distinct advantages and limitations. Electrophoretic mobility shift assay provides a straightforward method for detecting palmitoylation, as demonstrated by the reduced migration of palmitoylated Snc1 compared to the unmodified protein in SDS-PAGE . The specificity of this mobility shift can be confirmed through hydroxylamine treatment, which cleaves thioester bonds and abolishes the mobility difference between palmitoylated and unpalmitoylated proteins . For proteins where electrophoretic mobility changes are subtle, more sensitive approaches like biotin-BMCC labeling can be employed, which selectively biotinylates free cysteine residues, allowing unpalmitoylated proteins to be purified on streptavidin beads and detected by immunoblotting . Metabolic labeling with [3H]palmitate represents another approach, though this was reported as unsuccessful for Tlg1, possibly due to low turnover or synthesis rates . Mass spectrometry-based approaches, while not mentioned in the search results, could provide precise identification and quantification of palmitoylation sites. For functional assessment of palmitoylation, researchers can employ mutagenesis approaches, replacing cysteine residues with serine or leucine and examining the effects on protein stability and localization .

How can researchers design experiments to identify novel SWF1 substrates?

Designing experiments to identify novel SWF1 substrates requires a systematic approach combining genetic, biochemical, and proteomic techniques. A primary strategy would involve comparative proteomic analysis of wild-type and swf1Δ mutant strains to identify proteins with altered modification status, similar to the approach used to identify Snc1, Syn8, and Tlg1 as SWF1 substrates . Researchers could employ palmitoyl-protein enrichment methods such as acyl-biotin exchange (ABE) or acyl-resin-assisted capture (acyl-RAC) followed by mass spectrometry to identify palmitoylated proteins that show reduced modification in swf1Δ strains. Candidate substrates could be further validated through site-directed mutagenesis of predicted palmitoylation sites, examining changes in protein electrophoretic mobility upon hydroxylamine treatment, and assessing protein stability in wild-type versus swf1Δ backgrounds . In vitro palmitoylation assays using purified recombinant SWF1 and candidate substrates could provide direct evidence of enzymatic activity. Additionally, bioinformatic approaches could help identify proteins with structural features similar to known SWF1 substrates, particularly transmembrane proteins with cysteines in proximity to membrane interfaces. The functional consequences of palmitoylation can be assessed by comparing the localization, stability, and activity of wild-type proteins versus cysteine-to-serine mutants that cannot be palmitoylated .

What purification strategies are most effective for isolating recombinant SWF1?

Effective purification of recombinant SWF1 requires strategies optimized for membrane proteins while maintaining enzymatic activity. Based on approaches used for similar enzymes, affinity chromatography using tags such as polyhistidine represents a primary purification method . The design of expression constructs should incorporate affinity tags positioned to minimize interference with enzyme activity, potentially at the C-terminus as implemented for sulfatases . Since SWF1 is a membrane-associated protein localized to the ER , detergent solubilization will likely be necessary during purification, requiring careful selection of detergents that effectively extract the protein while preserving its native conformation and activity. A multi-step purification approach might include initial affinity chromatography followed by size exclusion chromatography to achieve higher purity. Quality control of purified SWF1 should include assessment of purity by SDS-PAGE, confirmation of identity by mass spectrometry or immunoblotting, and verification of enzymatic activity using substrate palmitoylation assays. For structural studies, techniques for membrane protein crystallization or cryo-electron microscopy sample preparation may be necessary. Throughout the purification process, maintaining proper buffer conditions including pH, salt concentration, and potentially the presence of reducing agents is crucial for preserving enzyme stability and activity.

How can researchers design mutational studies to understand SWF1 structure-function relationships?

Designing effective mutational studies to elucidate SWF1 structure-function relationships requires a strategic approach targeting key functional domains and residues. Researchers should first focus on the conserved DHHC motif that defines this enzyme family, creating single and combined alanine substitutions to assess the contribution of each residue to catalytic activity . Beyond the catalytic domain, mutations in predicted substrate-binding regions could help identify determinants of substrate specificity that enable SWF1 to selectively modify certain SNARE proteins. The transmembrane domains of SWF1 likely play crucial roles in proper localization and orientation within the ER membrane, making them important targets for mutation and chimeric protein studies . Complementation assays in swf1Δ strains provide a powerful tool for assessing mutant functionality, evaluating whether specific mutations can rescue phenotypes such as Tlg1 degradation, altered Snc1 migration, or inability to grow on lactate . Researchers could also create chimeric proteins swapping domains between SWF1 and other DHHC palmitoyltransferases to identify regions responsible for substrate recognition. For comprehensive structural insights, homology modeling based on related palmitoyltransferases with solved structures could guide rational mutation design, similar to the approach used for sulfatases SWF1 and SWF4 .

What control experiments are essential when studying SWF1-mediated palmitoylation?

When investigating SWF1-mediated palmitoylation, several critical control experiments must be incorporated to ensure reliable and interpretable results. Negative controls should include analysis of substrate proteins in swf1Δ strains to establish baseline unpalmitoylated states, while positive controls might involve well-characterized SWF1 substrates like Snc1, Syn8, or Tlg1 . Hydroxylamine treatment serves as an essential chemical control to confirm that observed mobility shifts or other modifications are indeed due to thioester-linked palmitoylation, as demonstrated for Syn8 and Tlg1 . Site-directed mutagenesis of substrate cysteine residues to serine or leucine provides another crucial control to verify specific palmitoylation sites and distinguish their effects from other potential modifications . When introducing tagged versions of SWF1 or substrate proteins, controls confirming that the tags don't interfere with protein function are essential, as performed for HA-tagged and GFP-tagged SWF1 . For recombinant protein studies, enzyme activity controls including heat-inactivated enzyme preparations and catalytically inactive mutants help establish specificity. Time course experiments can serve as kinetic controls to distinguish between direct and indirect effects of SWF1 activity. Additionally, specificity controls comparing the effects of deleting different palmitoyltransferases help establish the unique role of SWF1, as was done with the seven DHHC-CDR family members in yeast .

How can researchers integrate genetic and biochemical approaches to study SWF1 function?

Integrating genetic and biochemical approaches creates a powerful framework for comprehensive investigation of SWF1 function. Researchers should begin with genetic manipulations, including creation of precise knockout strains using homologous recombination as implemented for Snf1 in Y. lipolytica , or CRISPR-Cas9 systems for more challenging organisms. Complementation studies introducing wild-type or mutated SWF1 into knockout backgrounds can define critical residues and domains . These genetic tools should be coupled with biochemical assays measuring SWF1 activity, substrate modification, and protein-protein interactions. Proximity labeling approaches like BioID or APEX could identify proteins in close spatial relationship to SWF1 in living cells, potentially revealing novel substrates or regulatory partners. Researchers can leverage the localization of SWF1 to the ER by performing subcellular fractionation followed by activity assays or proteomics to examine compartment-specific functions . For studying recombinant SWF1, in vitro reconstitution of palmitoylation using purified components would provide mechanistic insights into substrate recognition and catalysis. Conditional genetic systems (temperature-sensitive mutants, auxin-inducible degrons) could enable temporal control of SWF1 function to distinguish between direct and indirect effects. Finally, comparative studies between SWF1 from Y. lipolytica and other organisms could reveal species-specific adaptations in enzyme function related to different metabolic capabilities .

How might SWF1 engineering contribute to metabolic optimization in Yarrowia lipolytica?

Engineering SWF1 could significantly impact metabolic optimization in Y. lipolytica by modulating protein stability and trafficking pathways that influence lipid metabolism and protein secretion. Y. lipolytica is known for its ability to metabolize glucose and accumulate lipids intracellularly, making it valuable for biotechnological applications . Drawing parallels from the effects of Snf1 disruption, which increased lipid production and enhanced protein secretion , modulation of SWF1 activity might similarly affect cellular resource allocation by altering the stability of key metabolic enzymes through palmitoylation. Researchers could pursue several engineering strategies, including overexpression of native or modified SWF1 to increase palmitoylation of target proteins, substrate specificity engineering to direct palmitoylation toward specific metabolic enzymes, or creation of synthetic regulatory circuits controlling SWF1 expression in response to metabolic signals. The connection between protein modification pathways and lipid metabolism highlighted in the Snf1 studies suggests that SWF1 could be an additional target for metabolic rewiring . Furthermore, since SWF1 affects membrane protein stability, engineering this enzyme could enhance the secretion of industrially relevant proteins by protecting them from degradation, similar to how it protects Tlg1 from the Tul1 degradation pathway .

What research directions might elucidate the evolutionary conservation of SWF1 function across species?

Exploring the evolutionary conservation of SWF1 function across species represents a rich area for future research with implications for understanding fundamental aspects of eukaryotic cell biology. Comparative genomic approaches could identify SWF1 orthologs across fungal lineages, from model yeasts like S. cerevisiae to industrial species like Y. lipolytica, examining sequence conservation particularly in the DHHC domain and potential substrate-binding regions . Functional complementation studies introducing SWF1 from different species into swf1Δ yeast strains would determine whether the proteins can substitute for each other, revealing conserved functional properties despite potential sequence divergence. Researchers could perform comprehensive substrate profiling across species to determine whether SWF1 orthologs modify the same set of proteins, particularly focusing on conserved SNARE proteins like Snc1, Syn8, and Tlg1 . The localization of SWF1 to the ER appears consistent across studied systems , but systematic investigation across diverse species could reveal potential adaptations in subcellular targeting. Comparative analysis of SWF1-dependent cellular phenotypes, such as growth defects on specific carbon sources or sensitivity to membrane stressors, would highlight conserved physiological roles. Additionally, examining SWF1 in the context of different metabolic capabilities, such as the oleaginous nature of Y. lipolytica versus non-oleaginous yeasts, could reveal specialized functions that have evolved in particular lineages .

What technological innovations might enhance our ability to study SWF1 activity and function?

Advancing our understanding of SWF1 will benefit from several technological innovations that could overcome current limitations in studying protein palmitoylation. Development of clickable palmitate analogs that can be metabolically incorporated into proteins and subsequently detected with high sensitivity would improve identification of SWF1 substrates without relying on mobility shifts or radioactive labeling, addressing challenges encountered with [3H]palmitate labeling of proteins like Tlg1 . CRISPR-based genetic screens could identify genes that modify SWF1 function or compensate for its loss, revealing regulatory networks and functional interactions. Improved structural biology techniques for membrane proteins, particularly advances in cryo-electron microscopy, could enable determination of SWF1 structure in complex with substrates, providing unprecedented insights into the molecular basis of substrate recognition and catalysis. Development of real-time palmitoylation sensors based on fluorescence resonance energy transfer (FRET) or bioluminescence resonance energy transfer (BRET) would allow monitoring of SWF1 activity in living cells with temporal and spatial resolution. Advances in mass spectrometry for comprehensive palmitoylome analysis would facilitate global identification of SWF1 substrates and quantification of palmitoylation stoichiometry. Furthermore, microfluidic approaches for high-throughput screening of SWF1 variants could accelerate enzyme engineering efforts aimed at modifying substrate specificity or enhancing catalytic efficiency for biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.