Recombinant Yarrowia lipolytica Peroxisomal biogenesis factor 2 (PEX2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Yarrowia lipolytica Peroxisomal Biogenesis Factor 2 (PEX2)

Recombinant Yarrowia lipolytica Peroxisomal Biogenesis Factor 2 (PEX2) is a protein crucial for the assembly and function of peroxisomes in the yeast Yarrowia lipolytica. Peroxisomes are organelles involved in various metabolic processes, including fatty acid oxidation, amino acid metabolism, and detoxification of reactive oxygen species. PEX2 is part of a family of proteins known as peroxins, encoded by PEX genes, which are essential for peroxisome biogenesis and maintenance.

Function of PEX2 in Peroxisomal Biogenesis

PEX2 is an integral membrane protein of peroxisomes and plays a significant role in the import of peroxisomal matrix proteins. It is involved in the early steps of peroxisome assembly and is crucial for maintaining the structural integrity of peroxisomes. In Yarrowia lipolytica, mutations affecting PEX2 or other peroxins can lead to impaired peroxisomal function, resulting in the inability to utilize certain carbon sources like oleic acid .

Research Findings on PEX2

Research on PEX2 in Yarrowia lipolytica highlights its importance in peroxisomal biogenesis. Studies have shown that mutations in pex19, another peroxin, lead to reduced levels of PEX2, indicating a potential interaction between these proteins in maintaining peroxisomal membrane stability . The interaction between PEX2 and other peroxins like PEX19 suggests a complex network of proteins involved in peroxisome assembly and function.

Recombinant Expression of PEX2

Recombinant expression of PEX2 involves the production of this protein in a controlled environment, often using bacterial or yeast expression systems. This approach allows for the large-scale production of PEX2 for research purposes, enabling detailed studies of its structure and function. Recombinant PEX2 can be used to investigate protein-protein interactions, enzymatic activities, and its role in peroxisomal biogenesis.

Data and Tables

While specific data tables for recombinant Yarrowia lipolytica PEX2 are not readily available in the provided sources, research findings typically involve biochemical assays, subcellular localization studies, and interaction analyses. For example, studies might include:

ProteinFunctionLocalization
PEX2Integral membrane protein involved in peroxisomal biogenesisPeroxisomal membrane
PEX19Stabilizes peroxisomal membrane proteinsPeroxisomal membrane

References

  1. Yarrowia lipolytica Pex20p, Saccharomyces cerevisiae Pex18p... .

  2. Yarrowia lipolytica Cells Mutant for the Peroxisomal Peroxin Pex19p... .

  3. Recombinant Full Length Yarrowia Lipolytica Peroxisomal... .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
PEX2; PAY5; YALI0F01012g; Peroxisomal biogenesis factor 2; Peroxin-2; Peroxisomal protein PAY5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-381
Protein Length
full length protein
Species
Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica)
Target Names
PEX2
Target Protein Sequence
MSSVLRLFKIGAPVPNVRVHQLDASLLDAELVDLLKNQLFKGFTNFHPEFRDKYESELVL ALKLILFKLTVWDHAITYGGKLQNLKFIDSRHSSKLQIQPSVIQKLGYGILVVGGGYLWS KIEGYLLARSEDDVATDGTSVRGASAARGALKVANFASLLYSAATLGNFVAFLYTGRYAT VIMRLLRIRLVPSQRTSSRQVSYEFQNRQLVWNAFTEFLIFILPLLQLPKLKRRIERKLQ SLNVTRVGNVEEASEGELAHLPQKTCAICFRDEEEQEGGGGASHYSTDVTNPYQADCGHV YCYVCLVTKLAQGDGDGWNCYRCAKQVQKMKPWVDVDEAAVVGAAEMHEKVDVIEHAEDN EQEEEEFDDDDEDSNFQLMKD
Uniprot No.

Target Background

Function
Essential for the import of various proteins into peroxisomes.
Database Links
Protein Families
Pex2/pex10/pex12 family
Subcellular Location
Peroxisome membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.