Recombinant Yarrowia lipolytica pH-response regulator protein palI/RIM9 (RIM9)

Shipped with Ice Packs
In Stock

Description

Role in pH-Responsive Signaling and Filamentation

RIM9 operates within the Rim101/PacC pathway, which coordinates alkaline pH adaptation and morphogenesis:

Key Functional Insights:

  • Filamentation Regulation: RIM9 is essential for alkaline pH-induced filamentation. Deletion strains (ΔRIM9) show impaired hyphal growth at pH ≥7.0, while constitutively active mutants induce filamentation even at acidic pH .

  • Protease Secretion: Regulates alkaline protease (XPR2) secretion but not acid protease (AXP2) expression, indicating pathway specificity .

  • Cell Wall Dynamics: Controls expression of adhesins (e.g., YlPHR1) and glycosidases critical for cell wall remodeling under alkaline conditions .

Comparative Analysis of RIM9-Dependent Phenotypes:

ConditionWild-Type PhenotypeΔRIM9 PhenotypeConstitutively Active Mutant Phenotype
pH 4.0Yeast formYeast formMild filamentation
pH 7.5Filamentous formReduced filamentation (<30 μm)N/A
Protease SecretionAlkaline protease+Alkaline protease-Constitutive protease+

Biotechnological Applications

Recombinant RIM9 is leveraged to engineer Y. lipolytica strains for industrial protein production:

Research Findings:

  • Transcriptional Networks: Overexpression (OE) of RIM9 and allied transcription factors (e.g., Hac1, Mhy1) enhances recombinant protein (rProt) yields by >2-fold through metabolic fine-tuning .

  • Strain Optimization:

    • Knockout (KO) of RIM9 disrupts pH-responsive pathways, enabling researchers to decouple growth phase from production phase .

    • Combinatorial TF engineering (OE + KO) improves secretion capacity in high-throughput chassis strains .

Case Study: Erythritol-Inducible Systems

RIM9-modified strains show enhanced performance in erythritol-inducible platforms, achieving:

  • Improved folding/trafficking of heterologous proteins via ER stress response modulation .

  • Increased cell wall porosity for efficient protein secretion .

Future Directions

  • Mechanistic Studies: Resolving RIM9’s interaction with YlRim101 and Mhy1 to map pH-responsive TRNs .

  • Industrial Scale-Up: Integrating RIM9-engineered strains into glycoengineering platforms for therapeutic protein production .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing it.
Synonyms
RIM9; YALI0E33627g; pH-response regulator protein palI/RIM9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-728
Protein Length
full length protein
Species
Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica)
Target Names
RIM9
Target Protein Sequence
MGLRMKSATGLLVILLIAFALQLVAVLSVPVTKTISLGSYQDHKFGVFGYCNVKDGTCSP AGVGYNLVDSDNAGFSLPSNARHTLSNLLIVHPIATGFTLILTVLAMLAHIQGPASSSRY LLFCLVFSLPTFLLVLLSFLVDILLFVPHLDWGGWIVLAATILVAISGVVLCVMRRTLSS KKAMKKHQLDTTNELSAFSSHKHLNSFTYSSKENVPQFSELRYETSHDTSKDEEVLPLTS HVYEEPGHHVGDTSYASQGTNNSRVNLLTSEEPQAPKRESPFKDQRQDRYTPDRYGPSPD RYDQGGPGRPPNGSRGVPPRRPSNGPTPPGQGPSPTGAYGRNNNPNYNGGYNNRLPRPRG PPGSNNSSPFLGARNGPGLTPPHNLQTATTGPMQLPAGTYLPGEEPANSPDTYGPGVIPI PEIRRESKVPGASPTPPPVSGNSPPTETSESGVSRPYRGNYSRRGSEASAQTPPNAQPNP PPGGAQNYEYVPARQQWNLTTEESNATAPAPGPQPLQRNHSYDTYNPYRSETPSAPGSRA QSQGTDDNLGTLHQPVPTTVTPSNSGALNNKDSPWYSPPVDEQFRNSFIPDAPVSPSESI SSNFTSVSQRGINPRYFGADGPPGGLHQGAPPPPHMRGPPPHMGMGGPNMGGHNMGGHNM GGPPPNMGPRPPYGGGGPGHGNKHDLLLSGNPDSQFQPQTRRKPGRGGRPGMSPASLMGR DTGPYSMR
Uniprot No.

Target Background

Function
Essential for the proteolytic cleavage of the transcription factor RIM101 in response to alkaline ambient pH.
Database Links
Protein Families
PalI/RIM9 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does the structure of YlRIM9 compare to its homologs in other fungal species?

The YlRIM9 gene encodes a protein containing 724 amino acids with specific structural features including a predicted signal peptide and four transmembrane domains concentrated in its N-terminal region . This structural arrangement is consistent with its presumed role as a membrane-associated protein involved in sensing or transducing pH signals. While the search results don't provide direct comparative structural data with other fungal species, it is known that RIM9/palI is part of the conserved Pal/Rim pathway that operates in various fungi including Aspergillus nidulans, where it was first characterized, and Candida albicans . The conservation of this pathway across divergent fungal species suggests functional conservation of its components, including RIM9/palI, although species-specific variations in protein structure and function likely exist to accommodate different ecological niches and physiological requirements.

What experimental evidence distinguishes the role of RIM9/palI from that of RIM101 in pH-responsive cellular adaptations?

Experimental evidence from mutation studies provides key insights into the differential roles of RIM9/palI and RIM101 in Y. lipolytica's pH responses. Research has demonstrated that mutations in YlRIM9, along with other genes encoding members of the Pal/Rim pathway, do not affect the pH-dependent dimorphic transition of Y. lipolytica . This suggests that RIM9/palI is not directly involved in regulating morphological changes in response to pH. In contrast, YlRIM101 has been identified as a major regulator of alkaline-induced filamentation, as deletion of RIM101 severely impaired filamentation at alkaline pH . Furthermore, expression of a constitutively active YlRIM101 1-330 mutant induced mild filamentation even at acidic pH . This indicates that while both proteins are part of the Pal/Rim pathway, RIM101 plays a crucial role in filamentation that RIM9/palI does not. The evidence suggests that RIM9/palI may function upstream of RIM101 in the signaling pathway, potentially involved in sensing pH changes and transmitting signals that ultimately lead to RIM101 activation, but not directly controlling morphological transitions.

How can researchers differentiate between the direct transcriptional targets of RIM9/palI and those regulated by other components of the Rim pathway?

Differentiating between direct transcriptional targets of RIM9/palI and those regulated by other components of the Rim pathway requires sophisticated experimental approaches. Researchers should consider implementing the following methodological strategy:

  • Comparative transcriptome analysis: Perform RNA-Seq on wild-type strains and strains with specific deletions of YlRIM9, YlRIM101, and other Rim pathway components under both acidic and alkaline conditions . This approach helps identify genes with altered expression patterns specific to each mutant.

  • Chromatin immunoprecipitation followed by sequencing (ChIP-Seq): This technique can identify DNA binding sites of transcription factors like RIM101, helping to distinguish direct targets from indirect effects . Since RIM9/palI is not itself a transcription factor but likely functions in signal transduction, ChIP-Seq would primarily help identify the direct targets of downstream transcription factors.

  • Promoter-reporter fusion assays: As demonstrated in the research on YlRIM101, promoter-lacZ reporters can be used to monitor the transcriptional activity of candidate target genes in different genetic backgrounds . This approach can help determine whether gene regulation depends on RIM9/palI or other pathway components.

  • Epistasis analysis: By creating double mutants (e.g., Ylrim9Δ rim101Δ) and comparing their phenotypes and gene expression profiles to single mutants, researchers can establish the hierarchical relationship between pathway components and their respective transcriptional impacts.

  • Time-course experiments: Analyzing gene expression changes over time following pH shifts can help distinguish between early and late responding genes, potentially separating direct from indirect targets.

Through these approaches, researchers could determine that YlRIM101 regulates the expression of the majority of alkaline-regulated cell wall protein genes, particularly those highly upregulated at alkaline pH . Similar methodologies could be applied to clarify the specific role of RIM9/palI in transcriptional regulation.

What are the current hypotheses regarding the evolutionary conservation of RIM9/palI across different fungal species?

Current hypotheses regarding the evolutionary conservation of RIM9/palI across fungal species center around its fundamental role in pH adaptation, which represents a critical environmental challenge for fungi. While the search results don't directly address evolutionary aspects, several hypotheses can be formulated based on the available information:

Testing these hypotheses would require comparative genomic analyses across multiple fungal species, functional complementation studies, and detailed structural analyses of RIM9/palI homologs - approaches not directly addressed in the provided search results.

What are the recommended approaches for generating and verifying RIM9/palI deletion mutants in Y. lipolytica?

Creating and verifying RIM9/palI deletion mutants in Y. lipolytica requires careful methodological considerations to ensure successful gene disruption and accurate phenotypic analysis. Based on approaches used in related research, the following protocol is recommended:

  • Construct deletion cassette:

    • Design primers to amplify a selectable marker (e.g., URA3, LEU2) flanked by homologous sequences (500-1000 bp) corresponding to the regions upstream and downstream of the YlRIM9 gene .

    • The homologous sequences should be carefully selected to ensure specific targeting and complete deletion of the coding region.

  • Transform Y. lipolytica:

    • Prepare competent cells of the wild-type strain (e.g., PO1a strain as used in previous studies) .

    • Use lithium acetate or electroporation methods for transformation with the deletion cassette.

    • Select transformants on appropriate selective media lacking the corresponding auxotrophic marker.

  • Verify deletion:

    • PCR verification: Design primers that bind outside the integration site and within the marker gene to confirm correct integration.

    • Southern blot analysis: Use to verify the absence of the target gene and single integration of the marker.

    • Whole genome sequencing or targeted sequencing can provide additional verification.

  • Complementation analysis:

    • Reintroduce the YlRIM9 gene into the deletion mutant to confirm that any observed phenotypes are specifically due to the absence of RIM9/palI, as was done with RIM101 in previous studies .

    • This can be achieved using an expression vector containing the native promoter and coding sequence of YlRIM9.

  • Phenotypic verification:

    • Assess protease secretion patterns at different pH values, as changes in alkaline protease production would be expected in Rim pathway mutants .

    • Evaluate growth at different pH values to assess pH adaptation capabilities.

    • Examine cellular morphology under various conditions, although RIM9/palI mutations are not expected to affect dimorphic transition .

Combining these approaches provides robust validation of RIM9/palI deletion mutants, establishing a foundation for subsequent functional studies.

What experimental systems are most effective for studying the interaction between RIM9/palI and other components of the Rim pathway?

Several experimental systems prove particularly effective for investigating interactions between RIM9/palI and other Rim pathway components:

  • Yeast two-hybrid (Y2H) assays:

    • Enable detection of direct protein-protein interactions between RIM9/palI and other Rim pathway components.

    • Design constructs with the predicted cytoplasmic domains of RIM9/palI fused to DNA-binding domains and potential interacting partners fused to activation domains.

    • This approach is especially useful for mapping the interaction network within the Rim pathway.

  • Co-immunoprecipitation (Co-IP) coupled with mass spectrometry:

    • Express epitope-tagged versions of RIM9/palI (preserving the native transmembrane domains) in Y. lipolytica.

    • Perform immunoprecipitation under different pH conditions to capture pH-dependent interactions.

    • Mass spectrometry analysis of co-precipitated proteins can identify both known Rim pathway components and novel interactors.

  • Bimolecular fluorescence complementation (BiFC):

    • Fuse complementary fragments of fluorescent proteins to RIM9/palI and other Rim pathway components.

    • This allows visualization of protein interactions in living cells and can reveal the subcellular localization of these interactions.

    • Particularly valuable for understanding how RIM9/palI, with its transmembrane domains, interacts with other components in cellular membranes.

  • Epistasis analysis using double and triple mutants:

    • Generate combinations of deletions in YlRIM9 and other Rim pathway genes.

    • Analyze phenotypes related to pH response, including alkaline protease secretion and gene expression patterns.

    • This approach, as demonstrated with other Rim components, helps establish the hierarchical relationship within the pathway .

  • Fluorescence microscopy with tagged proteins:

    • Create fluorescent protein fusions with RIM9/palI and other pathway components.

    • Monitor their localization and potential co-localization under different pH conditions.

    • This can reveal dynamic changes in protein distribution during pH response.

These complementary approaches provide a comprehensive understanding of RIM9/palI interactions, offering insights at both molecular and cellular levels.

What are the critical parameters for expressing and purifying recombinant RIM9/palI protein for structural and functional studies?

Expressing and purifying recombinant RIM9/palI protein presents significant challenges due to its transmembrane domains. The following parameters are critical for successful production:

  • Expression system selection:

    • Eukaryotic expression systems (e.g., Pichia pastoris, insect cells) are preferred over bacterial systems due to RIM9/palI's eukaryotic origin and membrane localization.

    • Mammalian cell expression systems may be necessary if post-translational modifications are critical for function.

    • Consider using cell-free expression systems optimized for membrane proteins as an alternative.

  • Construct design:

    • Design constructs that include the predicted signal peptide and four transmembrane domains identified in the N-terminal region .

    • For structural studies, consider creating truncated versions that isolate soluble domains.

    • Include affinity tags (e.g., His6, FLAG) for purification, positioned to minimize interference with protein folding.

    • Codon optimization for the chosen expression system can improve yield.

  • Solubilization and membrane protein handling:

    • Screen multiple detergents (e.g., DDM, LMNG, GDN) to identify optimal conditions for extracting RIM9/palI from membranes while maintaining native conformation.

    • Consider nanodiscs or amphipols for stabilizing the protein in a near-native lipid environment.

    • Maintain strict temperature control during purification to prevent aggregation.

  • Purification strategy:

    • Implement a multi-step purification protocol:

      • Initial affinity chromatography using the incorporated tag

      • Size exclusion chromatography to remove aggregates and contaminants

      • Ion exchange chromatography for final polishing if needed

    • Verify protein integrity at each step by SDS-PAGE and Western blotting.

  • Quality control:

    • Assess protein homogeneity by dynamic light scattering or analytical ultracentrifugation.

    • Verify proper folding using circular dichroism spectroscopy.

    • For functional studies, develop binding assays to confirm interaction with known partners from the Rim pathway.

  • Stabilization for structural studies:

    • For crystallization attempts, screen stabilizing additives and consider antibody fragments or nanobodies to provide crystal contacts.

    • For cryo-electron microscopy, optimize grid preparation protocols specifically for membrane proteins.

By meticulously controlling these parameters, researchers can overcome the challenges inherent in working with membrane proteins like RIM9/palI, facilitating both structural and functional analyses.

How does RIM9/palI function in relation to the YlRIM101 transcription factor in the pH response pathway?

RIM9/palI functions primarily as an upstream component in the pH signaling pathway that ultimately regulates the activity of the YlRIM101 transcription factor in Y. lipolytica. Based on the current understanding of this pathway:

RIM9/palI likely serves as a pH sensor or signal transducer with its four transmembrane domains in the N-terminal region , positioning it as a membrane-associated protein capable of detecting environmental pH changes. This aligns with its structural features and predicted topology. In the canonical Pal/Rim pathway, palI/RIM9 is believed to be one of the earliest components to respond to pH changes, initiating a signaling cascade.

The signal detected or transduced by RIM9/palI is then relayed through other Rim pathway components, ultimately leading to the proteolytic processing and activation of the YlRIM101 transcription factor. This processing converts YlRIM101 from an inactive to an active form capable of regulating gene expression .

Once activated, YlRIM101 functions as a major regulator of alkaline-induced filamentation and controls the expression of numerous pH-responsive genes, particularly cell wall protein genes . YlRIM101 has been shown to regulate the expression of the majority of alkaline-regulated cell wall protein genes, with 14 out of 15 highly alkaline-upregulated cell wall protein genes being YlRIM101-regulated .

Importantly, while RIM9/palI is involved in the pH signaling pathway leading to YlRIM101 activation, research has shown that mutations in YlRIM9 do not affect the pH-dependent dimorphic transition of Y. lipolytica , unlike mutations in YlRIM101 which severely impair filamentation at alkaline pH . This suggests that either RIM9/palI's role in YlRIM101 activation is partially redundant with other pathway components, or that YlRIM101 can be activated through alternative mechanisms in certain contexts.

The relationship between these proteins highlights the complexity of pH signaling in Y. lipolytica, where different components of the same pathway may have overlapping yet distinct functions in regulating various aspects of pH response.

What is currently known about the molecular mechanisms by which RIM9/palI senses or responds to pH changes?

Current understanding of the molecular mechanisms by which RIM9/palI senses or responds to pH changes remains limited, but several models can be proposed based on its structural features and role in the Rim pathway:

The presence of four transmembrane domains in the N-terminal region of RIM9/palI suggests it functions as a membrane-embedded sensor. These transmembrane domains likely position the protein to detect changes in environmental pH or pH-induced alterations in membrane properties. Possible sensing mechanisms include:

  • Direct pH sensing: The extracellular or membrane-embedded domains of RIM9/palI might contain pH-sensitive residues (histidines, aspartates, or glutamates) that undergo protonation/deprotonation in response to pH changes, triggering conformational changes that initiate signaling.

  • Indirect sensing through membrane alterations: Changes in environmental pH may alter membrane fluidity or organization, which RIM9/palI could detect through its transmembrane domains, translating physical membrane changes into signaling events.

  • Interaction with pH-sensitive ligands: RIM9/palI might bind to extracellular molecules whose conformation or binding affinity is pH-dependent, with this interaction serving as the initial pH-sensing event.

Once RIM9/palI detects pH changes, it likely triggers a signaling cascade through protein-protein interactions with other Rim pathway components. In the canonical Pal/Rim pathway, these signals ultimately lead to the proteolytic processing and activation of the RIM101/PacC transcription factor .

It's noteworthy that in Y. lipolytica, mutations in YlRIM9 do not affect pH-dependent dimorphic transition , suggesting that either pH sensing for morphological changes occurs through a different pathway or that there is redundancy in the pH sensing mechanisms. This contrasts with the central role of YlRIM101 in alkaline-induced filamentation , indicating that while RIM9/palI may be involved in pH sensing for some responses, other sensors or pathways must exist for dimorphic transitions.

Further research using techniques such as site-directed mutagenesis of potential pH-sensing residues, fluorescence-based pH sensors fused to RIM9/palI domains, and detailed structural studies would be needed to fully elucidate the molecular mechanisms of pH sensing by this protein.

How does the function of RIM9/palI coordinate with other pH response mechanisms to regulate metabolic outputs in Y. lipolytica?

The function of RIM9/palI coordinates with multiple pH response mechanisms to regulate diverse metabolic outputs in Y. lipolytica, creating an integrated cellular response to environmental pH changes:

In the context of protease secretion, RIM9/palI, as part of the Pal/Rim pathway, contributes to the pH-dependent regulation of protease secretion, with Y. lipolytica secreting either an acidic or an alkaline protease depending on the environmental pH . This selective secretion optimizes nutrient acquisition under different pH conditions.

For metabolic regulation, while not directly studied for RIM9/palI, research on pH effects in Y. lipolytica has revealed that pH differentially affects citric acid and lipid production, with citric acid production enhanced at more neutral pH values and lipid production enhanced at more acidic pH values . This pH-dependent metabolic switch appears to be mediated primarily at the level of citric acid transport rather than through changes in enzyme expression . This finding suggests that pH-responsive transporters, potentially regulated by the Rim pathway, play a crucial role in determining metabolic outputs.

The transcriptional program regulated by YlRIM101, which functions downstream of RIM9/palI in the canonical pathway, controls the expression of numerous cell wall protein genes depending on pH . Many of these proteins likely contribute to cell wall remodeling and membrane functions that indirectly affect metabolic processes by altering nutrient uptake, secretion capabilities, and cellular energy demands.

Additionally, the Rim pathway interacts with other signaling mechanisms, as evidenced by the cooperation between YlRIM101 and the Msn2/Msn4-like transcription factor Mhy1 in regulating alkaline-induced filamentation . This cross-talk between signaling pathways allows for integrated responses to complex environmental conditions where pH may change alongside other factors.

It's also noteworthy that transcriptome analysis has revealed that the pH switch between citric acid and lipid production is governed by transporter expression , suggesting that membrane transport processes, potentially influenced by RIM9/palI and the Rim pathway, play a crucial role in metabolic regulation in response to pH.

The coordination of these various pH response mechanisms, including those involving RIM9/palI, enables Y. lipolytica to adapt its metabolism optimally to environmental pH changes, balancing growth, energy production, and specific metabolic outputs such as citric acid or lipid accumulation.

How do the transcriptional targets of the RIM pathway differ between neutral-alkaline and acidic pH conditions?

The transcriptional targets of the RIM pathway show distinct patterns of regulation between neutral-alkaline and acidic pH conditions, reflecting the adaptation strategies of Y. lipolytica to different environmental pH values:

Under neutral-alkaline conditions (pH 7.5), transcriptome analysis revealed 1,593 genes that were significantly differentially expressed compared to acidic conditions (pH 4.0), with 621 genes upregulated and 972 genes downregulated . Among these, cell wall protein genes show particularly striking pH-dependent regulation:

  • Alkaline-upregulated genes:

    • 41 cell wall protein genes were upregulated at alkaline pH

    • 14 of 15 highly alkaline-upregulated cell wall protein genes (93%) were YlRIM101-regulated

    • Key examples include YALI0E22286 (U4), YlPHR1 (U8), and YALI0C23452 (U19)

    • These genes are minimally expressed at acidic pH but strongly induced at alkaline pH

  • Alkaline-downregulated genes:

    • 26 cell wall protein genes were downregulated at alkaline pH

    • 14 of 16 highly alkaline-downregulated genes (87%) were YlRIM101-regulated

    • These genes show high expression at acidic pH but reduced expression at alkaline pH

Importantly, YlRIM101 appears to regulate these genes specifically in a pH-dependent manner, as the 41 alkaline-upregulated and 26 alkaline-downregulated cell wall proteins did not exhibit differential expression between wild-type and Ylrim101Δ strains at pH 4.0 . This indicates that YlRIM101 does not regulate these genes at acidic pH.

The pH-dependent regulation extends beyond cell wall proteins to affect metabolic pathways. For instance, citric acid production increases at more neutral pH values while lipid production is enhanced at more acidic pH values . This metabolic switch appears to be mediated at the level of citric acid transport, with multiple transporters showing increased expression at neutral pH .

Additionally, the transcription factor Mhy1, which cooperates with YlRIM101, is highly upregulated at alkaline pH and essential for filamentation . This represents another layer of pH-dependent transcriptional regulation.

These patterns of differential gene expression demonstrate how the RIM pathway orchestrates comprehensive cellular reprogramming in response to environmental pH changes, affecting cell wall composition, morphology, and metabolism.

What is known about the interaction between the RIM pathway and the Mhy1 transcription factor in regulating pH-responsive gene expression?

Research has revealed important insights into the interaction between the RIM pathway and the Mhy1 transcription factor in regulating pH-responsive gene expression in Y. lipolytica:

Mhy1, an Msn2/Msn4-like transcription factor, is highly upregulated at alkaline pH and plays an essential role in filamentation in Y. lipolytica . This upregulation at alkaline pH suggests that Mhy1 itself may be regulated by pH-responsive pathways, potentially including the RIM pathway.

YlRIM101 and Mhy1 function as co-regulators of pH-responsive gene expression, particularly for a subset of cell wall protein genes. Specifically, these two transcription factors positively co-regulate seven cell wall protein genes at alkaline pH, including YlPHR1 and five cell surface adhesin-like genes, three of which appear to promote filamentation . This co-regulation suggests either direct or indirect interaction between the RIM pathway and Mhy1-mediated transcriptional control.

Despite their cooperative function in regulating some genes, YlRIM101 and Mhy1 display distinct regulatory roles:

  • YlRIM101 specifically regulates alkaline-induced filamentation, as deletion of YlRIM101 severely impaired filamentation at alkaline pH

  • Mhy1 regulates both alkaline- and glucose-induced filamentation, as deletion of MHY1 abolished filamentation under both conditions

  • Overexpression of MHY1 induced strong filamentation regardless of pH or glucose presence, indicating that Mhy1 can function independently of pH signals in some contexts

The mechanistic basis for this interaction remains to be fully elucidated. Possibilities include:

  • Direct interaction between YlRIM101 and Mhy1 proteins

  • Cooperative binding to promoters of co-regulated genes

  • Sequential action where one factor facilitates the binding or activity of the other

  • Regulation of common cofactors or chromatin modifiers

Further research using techniques such as ChIP-seq to map binding sites, co-immunoprecipitation to detect physical interactions, and detailed promoter analysis of co-regulated genes would help clarify the precise nature of this interaction.

What experimental evidence supports the existence of alternative pH-sensing pathways independent of RIM9/palI in Y. lipolytica?

Several lines of experimental evidence support the existence of alternative pH-sensing pathways operating independently of RIM9/palI in Y. lipolytica:

The most compelling evidence comes from mutation studies which demonstrated that mutations in YlRIM9, as well as in other genes encoding members of the Pal/Rim pathway, did not affect the pH-dependent dimorphic transition of Y. lipolytica . This finding directly suggests that a different pathway must exist in this fungus that controls the effect of pH on dimorphism, operating independently of RIM9/palI and the classical Rim pathway.

Additionally, research on metabolic responses to pH provides indirect evidence for alternative pH-sensing mechanisms. Studies have shown that pH differentially affects citric acid and lipid production in Y. lipolytica W29, with citric acid production enhanced at more neutral pH values and lipid production enhanced at more acidic pH values . Transcriptome analysis suggested that this pH-dependent metabolic switch is mediated at the level of citric acid transport rather than changes in enzyme expression . While not directly linked to RIM9/palI in the provided research, this transport-level regulation may represent another pH-sensing mechanism operating alongside or independently of the Rim pathway.

The differential effects of pH on various cellular processes also suggest multiple pH-sensing systems. For example, while YlRIM101 (which functions downstream of RIM9/palI in the canonical pathway) specifically regulates alkaline-induced filamentation, the transcription factor Mhy1 regulates both alkaline- and glucose-induced filamentation . This indicates that Mhy1 responds to multiple signals, potentially through different sensing mechanisms, again suggesting the existence of alternative pathways.

The observation that YlRIM101 controls the expression of the majority of alkaline-regulated cell wall protein genes, particularly those highly upregulated at alkaline pH , while RIM9/palI mutations do not affect dimorphic transitions , suggests a potential bifurcation in the pH response pathway or the existence of partially redundant sensing mechanisms.

Collectively, these findings indicate that Y. lipolytica employs multiple pH-sensing pathways, with RIM9/palI functioning in some aspects of pH response (such as protease secretion) while other, currently uncharacterized mechanisms control other pH-dependent processes like dimorphic transitions. This complexity likely reflects the importance of pH adaptation for this organism's survival in diverse environments.

What are the most promising approaches for identifying the specific binding partners of RIM9/palI in the membrane environment?

Identifying the specific binding partners of RIM9/palI in its native membrane environment represents a significant challenge that requires specialized approaches:

Proximity-based labeling techniques offer particularly promising approaches for capturing transient or weak interactions in membrane environments:

  • BioID: By fusing a promiscuous biotin ligase (BirA*) to RIM9/palI, researchers can biotinylate proximal proteins, which can then be isolated and identified by mass spectrometry .

  • APEX2-based proximity labeling: This engineered peroxidase can be fused to RIM9/palI to generate short-lived radicals that label nearby proteins, providing a snapshot of the protein's interaction neighborhood.

  • Split-BioID or split-APEX systems: These can be designed to label proteins only when specific interactions occur, reducing background labeling.

Crosslinking mass spectrometry (XL-MS) techniques modified for membrane proteins can capture direct binding partners:

  • Photo-activatable or chemical crosslinkers can be incorporated into RIM9/palI either during synthesis or through cysteine-targeting approaches.

  • After crosslinking, protein complexes can be isolated and analyzed by mass spectrometry.

  • This approach provides information not only about binding partners but also about specific interaction interfaces.

Native membrane approaches preserve the lipid environment critical for proper membrane protein interactions:

  • Styrene maleic acid lipid particles (SMALPs) can extract membrane protein complexes along with their surrounding lipids without detergents.

  • Nanodiscs containing RIM9/palI can be used for pull-down assays or surface plasmon resonance studies to identify interaction partners.

  • Cryo-electron tomography of membrane extracts can visualize RIM9/palI in complex with its binding partners.

Genetic approaches can complement biochemical methods:

  • Synthetic genetic array (SGA) analysis identifying genes that show synthetic lethality or enhanced phenotypes when mutated alongside YlRIM9.

  • Suppressor screens identifying mutations that restore function in RIM9/palI mutants, potentially revealing functionally related proteins.

pH-dependent interaction studies are particularly relevant for RIM9/palI:

  • Performing interaction studies under different pH conditions may reveal pH-dependent binding partners.

  • Time-course studies following pH shifts can capture dynamic changes in the interaction network.

Combining these approaches would provide a comprehensive view of RIM9/palI's interaction network in the membrane environment, yielding insights into its role in pH sensing and signal transduction.

What are the key questions that remain unanswered about the structure-function relationship of RIM9/palI?

Several critical questions remain unanswered regarding the structure-function relationship of RIM9/palI, representing important avenues for future research:

  • pH-sensing mechanism:

    • Which specific domains or residues of RIM9/palI are responsible for sensing pH changes?

    • Are there histidine residues in strategic locations that might act as pH sensors through protonation/deprotonation?

    • How do conformational changes in response to pH propagate through the protein to initiate signaling?

  • Membrane topology and domain organization:

    • What is the precise topology of RIM9/palI's four transmembrane domains in the membrane?

    • Are there additional structural features beyond the identified signal peptide and transmembrane domains that contribute to function?

    • How does the three-dimensional arrangement of these domains facilitate pH sensing?

  • Signal transduction mechanism:

    • How does RIM9/palI transmit pH signals to downstream components of the Rim pathway?

    • Which specific protein-protein interaction interfaces are critical for signal propagation?

    • Are there post-translational modifications of RIM9/palI that regulate its activity in response to pH?

  • Regulatory mechanisms:

    • How is the expression and localization of RIM9/palI itself regulated in response to environmental conditions?

    • Are there feedback mechanisms that modulate RIM9/palI activity based on downstream pathway activation?

    • Do lipid interactions play a role in RIM9/palI function, and if so, is the lipid environment altered by pH?

  • Functional redundancy:

    • Why does mutation in YlRIM9 not affect pH-dependent dimorphic transition , unlike mutations in some other pH-response regulators?

    • Are there functionally redundant proteins that can compensate for RIM9/palI absence in certain contexts?

    • How does RIM9/palI function integrate with other pH-sensing mechanisms in Y. lipolytica?

  • Evolutionary adaptation:

    • How has the structure of RIM9/palI evolved across fungal species to adapt to different pH environments?

    • Are there structural variations that correlate with species-specific pH responses?

    • Which structural elements are most conserved, suggesting essential functional roles?

Addressing these questions would require a multidisciplinary approach combining structural biology (X-ray crystallography, cryo-EM), molecular dynamics simulations, mutagenesis studies, and functional assays. Such research would significantly advance our understanding of pH sensing mechanisms in fungi and potentially reveal new targets for antifungal development.

How might insights from RIM9/palI research be applied to improve biotechnological applications of Y. lipolytica?

Insights from RIM9/palI research offer significant potential for enhancing biotechnological applications of Y. lipolytica, particularly in optimizing production processes and developing novel genetic tools:

For metabolite production optimization, understanding RIM9/palI's role in pH signaling could enable precise control over metabolic outputs. Y. lipolytica produces different valuable compounds depending on environmental pH, with citric acid production enhanced at more neutral pH values and lipid production enhanced at more acidic pH values . By manipulating RIM9/palI and related pH-sensing pathways, researchers could potentially:

  • Develop strains with altered pH response thresholds to optimize production at preferred pH values

  • Create constitutively active or inactive variants that maintain specific metabolic states regardless of external pH

  • Engineer feedback-resistant variants that maintain high productivity despite changes in culture conditions

In recombinant protein production applications, the pH-dependent secretion of proteases in Y. lipolytica presents both challenges and opportunities. Since RIM9/palI is involved in the pathway controlling alkaline protease secretion , manipulating this protein could:

  • Reduce unwanted protease activity that degrades valuable recombinant proteins

  • Enhance secretion efficiency by optimizing the extracellular environment

  • Create strains with tailored protease secretion profiles for specific applications

For bioprocess design and monitoring, RIM9/palI could be utilized as a biosensing component:

  • Development of reporter strains where fluorescent proteins are expressed under the control of RIM9/palI-dependent promoters

  • Real-time monitoring of cellular pH responses in industrial fermentation

  • Creation of biosensors that detect subtle pH changes before they affect productivity

In strain engineering for robustness, understanding how RIM9/palI contributes to pH adaptation could:

  • Improve strain tolerance to pH fluctuations in industrial fermentation

  • Develop strains capable of maintaining productivity across a wider pH range

  • Enhance Y. lipolytica's ability to grow on various waste streams with challenging pH profiles

For synthetic biology applications, the RIM9/palI signaling pathway components could serve as building blocks for:

  • pH-responsive genetic circuits that trigger specific metabolic responses

  • Orthogonal signaling systems for controlled gene expression

  • Novel bioswitches that respond to external pH cues

By applying these insights, biotechnologists could develop more efficient and resilient Y. lipolytica strains for various industrial applications, potentially improving yields, reducing production costs, and enabling new bioprocesses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.