Recombinant Yarrowia lipolytica Presequence translocated-associated motor subunit PAM17, mitochondrial (PAM17)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
PAM17; YALI0B02992g; Presequence translocated-associated motor subunit PAM17, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
30-185
Protein Length
Full Length of Mature Protein
Species
Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica)
Target Names
PAM17
Target Protein Sequence
AGTAPVPLTWERFLLLRTRRRQINFVASIFTGVATSVLAWGFISEAELDLEQQDVFFGLD AFTAAGLGVVAAGFMGSLLGPTIGQLIFKATNSKQWPAFLMKETDFLSHIQKNRVNPRYQ SVSNPVPDYYGEKIGSLKDYRRWLRDCAKYNRAREV
Uniprot No.

Target Background

Function
A component of the PAM complex, essential for the ATP-dependent translocation of transit peptide-containing proteins from the inner mitochondrial membrane to the mitochondrial matrix.
Database Links
Protein Families
PAM17 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is PAM17 and what is its functional significance in mitochondrial protein import?

PAM17 is a critical component of the presequence translocase-associated motor (PAM) complex in mitochondria, identified as the sixth motor subunit alongside five previously known components: matrix heat shock protein 70 (mtHsp70), nucleotide exchange factor Mge1, Tim44, and the Pam16-Pam18 complex . This protein is encoded by the open reading frame YKR065c in yeast .

Functionally, PAM17 plays a crucial role in the mitochondrial protein import machinery by:

  • Facilitating the formation of a stable complex between cochaperones Pam16 and Pam18

  • Promoting the association of the Pam16-Pam18 complex with the presequence translocase

  • Contributing to the regulation of mtHsp70 activity at the inner membrane translocation site

  • Supporting the import-driving activity required for matrix protein translocation

Deletion studies clearly demonstrate that mitochondria lacking PAM17 are selectively impaired in their ability to import matrix-targeted proteins, while maintaining the capacity to insert proteins containing hydrophobic stop-transfer sequences into the inner membrane .

How is PAM17 structurally organized and where is it localized within mitochondria?

PAM17 is an inner mitochondrial membrane protein with specific structural characteristics:

  • Synthesized with a cleavable N-terminal presequence that is processed upon import into mitochondria

  • Anchored in the inner membrane with its functional domain exposed to the mitochondrial matrix

  • Resistant to extraction by alkaline treatment (pH 11.5), behaving like integral membrane proteins Tim23 and Tim50

  • Forms a distinct Blue Native PAGE (BN-PAGE) band of approximately 50 kDa, migrating separately from the Pam16-Pam18 complex

What phenotypes are associated with PAM17 deletion or mutation?

Phenotypic analysis of PAM17 mutations has revealed several important characteristics:

Growth Phenotypes:

  • Yeast cells lacking PAM17 (pam17Δ) show significant growth defects

  • The growth impairment is more pronounced at elevated temperatures (37°C)

  • Double mutants combining PAM17 deletion with mutations in other import machinery components (e.g., tim44 F54S) show synthetic growth defects, often leading to lethality

Protein Import Defects:

  • Mitochondria isolated from pam17Δ cells show selective impairment in the import of presequence-carrying matrix proteins

  • Presequence-carrying proteins with hydrophobic stop-transfer sequences can still be efficiently inserted into the inner membrane

  • The Δψ-independent motor activity with two-membrane-spanning preproteins is significantly reduced

Molecular Phenotypes:

  • Reduced steady-state level of Pam18 in pam17Δ mitochondria when cells are grown at elevated temperature

  • Decreased association of Pam16 and Pam18 with the TIM23 complex

  • Impaired formation of the stable Pam16-Pam18 complex

What are the critical residues and domains in PAM17 essential for its association with the translocon?

Detailed mutational analyses have identified key regions and residues in PAM17 critical for its function:

C-terminal Matrix Domain:

  • The region containing residues 165-185 is particularly conserved among fungal Pam17 orthologs

  • Within this region, residues 167-169 (aspartic acid and two tyrosines, abbreviated as DYY) are crucial for PAM17's association with the translocon

Specific Residue Analysis:

  • Mutation of tyrosines 168 and 169 to alanines (YY/AA) severely impaired PAM17's association with the translocon

  • The DYY/AAA triple mutant showed similar defects to the YY/AA double mutant, suggesting these tyrosines are particularly important

  • Single amino acid substitutions did not cause obvious phenotypes, indicating functional redundancy or structural plasticity in some regions

  • Sequence alignment of 10 fungal Pam17 orthologs to identify conserved regions

  • Site-directed mutagenesis targeting these conserved elements

  • Co-immunoprecipitation assays to assess the impact of mutations on translocon association

  • Growth phenotype analysis of resulting mutants

The experimental data demonstrated that while PAM17 DYY/AAA and PAM17 YY/AA mutants were expressed at levels equivalent to wild-type Pam17, their co-immunoprecipitation with the translocon was severely compromised .

How does PAM17 contribute to the organization and regulation of the Pam16-Pam18 complex?

PAM17 plays a critical role in organizing the Pam16-Pam18 complex, which directly impacts mitochondrial protein import:

Structural Organization:

  • PAM17 is required for the formation of a stable complex between Pam16 and Pam18

  • In mitochondria lacking PAM17, the BN-PAGE-stable association of Pam16 and Pam18 is strongly impaired

  • PAM17 promotes the association of the Pam16-Pam18 complex with the TIM23 complex

Regulatory Function:

  • PAM17 contributes to the regulation of mtHsp70 activity indirectly by ensuring proper organization of the Pam16-Pam18 complex

  • The Pam16-Pam18 complex directly regulates the ATPase activity of mtHsp70, which provides the driving force for protein translocation

  • In the absence of PAM17, the import-driving activity of PAM is significantly reduced

Experimental Evidence:
When PAM17 was deleted:

  • The amount of Pam16 and Pam18 recovered with tagged Tim23 was significantly decreased compared to wild-type mitochondria

  • The association of Pam16 and Pam18 with the TIM23 complex was reduced by approximately 80%, while other components like Tim44 and mtHsp70 remained largely unaffected

  • The residual Pam16-Pam18 complex in mutant mitochondria showed the same mobility on BN-PAGE as the wild-type complex, indicating PAM17 itself is not a subunit of this complex

This evidence suggests PAM17 functions as an assembly factor or stabilizer for the Pam16-Pam18 complex, rather than being a structural component of the complex itself.

What genetic interactions exist between PAM17 and other components of the mitochondrial import machinery?

Genetic interaction studies have revealed complex functional relationships between PAM17 and other components:

Interactions with Tim44:

  • Mutations in the N-terminus of Tim44 (such as F54S and Δ51-68) show strong synthetic interactions with pam17 deletion

  • Not all Tim44 mutations interact with pam17Δ - mutations like tim44Δ85-99 showed no genetic interaction

  • These patterns suggest specialized functional relationships beyond simple physical interactions

Interactions with Tim17:

  • The C-terminal truncation of Tim17 (tim17ΔC) shows severe synthetic interactions with pam17 deletion

  • This suggests a functional link between the C-terminus of Tim17 (which is located in the intermembrane space) and PAM17 (which is exposed to the matrix)

Interactions with Pam16:

  • PAM17 deletion shows strong synthetic interactions with mutations affecting the N-terminus of Pam16 (pam16Δ1-12)

  • This further supports the role of PAM17 in stabilizing the Pam16-Pam18 complex

Complex Interaction Patterns:
The pattern of genetic interactions with PAM17 differs from patterns observed with other components:

  • pam18ΔIMS showed no genetic interaction with PAM17 deletion, while showing interactions with other components

  • This suggests PAM17 has specialized functions in the import machinery beyond simple scaffolding

The table below summarizes key genetic interactions observed with PAM17:

MutationInteraction with pam17ΔPhenotype
tim44 F54SStrong synthetic interactionSevere growth defect
tim44Δ51-68Strong synthetic interactionSevere growth defect
tim44Δ85-99No significant interactionNormal growth
tim17ΔCStrong synthetic interactionExtremely poor growth
pam16Δ1-12Strong synthetic interactionSevere growth defect
pam18ΔIMSNo significant interactionNormal growth

These genetic interaction patterns provide valuable insights into the functional organization of the mitochondrial import machinery and the specialized role of PAM17 within this system.

What statistical approaches are appropriate for analyzing experimental data related to PAM17 function?

When analyzing data from PAM17 functional studies, researchers should consider these statistical approaches:

For Quantitative Import Assays:

  • Use measures of central tendency (mean) to determine average import efficiency across replicates

  • Apply measures of variability (standard deviation or standard error) to assess consistency

  • Employ t-tests for two-condition comparisons or ANOVA for multi-condition experiments to determine statistical significance

  • Report effect sizes to understand the magnitude of differences between conditions

For Growth Phenotype Analysis:

  • Apply appropriate transformations to growth data to ensure normality if required

  • Consider repeated measures analyses for time-course experiments

  • Use non-parametric tests if data violate assumptions of parametric tests

For Co-immunoprecipitation Quantification:

  • Normalize pulled-down protein amounts to the amount of bait protein

  • Use multiple biological replicates (minimum n=3) to ensure reproducibility

  • Consider the sensitivity and variability of detection methods when determining appropriate sample sizes

When designing experiments, researchers should:

  • Calculate appropriate sample sizes based on expected effect sizes

  • Include proper controls to account for experimental variability

  • Consider both Type I (false positive) and Type II (false negative) errors in experimental design

  • Use standardized protocols to reduce variability in experimental procedures

The reduction of unsystematic variability (random error) will improve the sensitivity of statistical tests to detect treatment effects related to PAM17 function .

What are the emerging questions regarding PAM17's role in mitochondrial biogenesis and function?

Several important research questions remain to be fully addressed:

Regulatory Mechanisms:

  • How is PAM17 function regulated under different cellular conditions?

  • Are there post-translational modifications that affect PAM17 activity?

  • How does PAM17 respond to cellular stress conditions that affect mitochondrial protein import?

Structural Biology:

  • What is the three-dimensional structure of PAM17 and how does this relate to its function?

  • How does PAM17 physically interact with the Pam16-Pam18 complex at the molecular level?

  • What conformational changes occur during the assembly and disassembly of the import machinery?

Evolution and Specialization:

  • How has PAM17 function evolved across different fungal species?

  • Are there specialized roles for PAM17 in organisms with unique mitochondrial characteristics?

  • Do higher eukaryotes have functional equivalents of PAM17, and how do they differ?

Pathological Implications:

  • Could mutations in PAM17 orthologs contribute to human mitochondrial disorders?

  • How does PAM17 function affect cellular responses to conditions that compromise mitochondrial protein import?

Systems Biology:

  • How does PAM17 function integrate with broader cellular pathways related to mitochondrial biogenesis?

  • What compensatory mechanisms exist when PAM17 function is compromised?

Addressing these questions will require interdisciplinary approaches combining structural biology, genetics, biochemistry, and systems-level analyses.

How can high-throughput methods be applied to better understand PAM17's interaction network?

Modern high-throughput approaches offer promising avenues for exploring PAM17's functional interactions:

Proximity-Based Proteomics:

  • BioID or APEX2 tagging of PAM17 to identify proximal proteins in the native cellular environment

  • Comparison of proximity interactomes under different cellular conditions

  • Integration with existing protein interaction data to build comprehensive models

Genetic Interaction Mapping:

  • Synthetic genetic array (SGA) analysis with PAM17 deletion or mutation

  • CRISPR-based genetic screens to identify novel functional connections

  • Quantitative analysis of genetic interactions to predict functional relationships

Structural Proteomics:

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map protein interaction surfaces

  • Cross-linking mass spectrometry (XL-MS) to identify specific residues involved in protein-protein interactions

  • Integration of experimental data with computational modeling approaches

Multi-Omics Integration:
Similar to approaches used for studying Y. lipolytica metabolism , researchers could apply:

  • Transcriptomics to analyze expression changes in PAM17 mutants

  • Metabolomics to assess downstream effects on mitochondrial function

  • Proteomics to evaluate changes in protein composition and post-translational modifications

These high-throughput approaches would generate comprehensive datasets that, when properly integrated, could provide unprecedented insights into PAM17's functional context within the mitochondrial import machinery and broader cellular processes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.