Recombinant Yarrowia lipolytica Probable endonuclease LCL3 (LCL3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with blue ice packs by default. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to your needs.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
LCL3; YALI0E30305g; Probable endonuclease LCL3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica)
Target Names
LCL3
Target Protein Sequence
MPEDSNKASNTARVVFYTSILTGGILSSFYVYSRYFRRFTCTAEVPKKIYRGRTLFGRVT SVGDGDNFHFYHTPGGRLAGWGWLRPYPETNKRGLGKETLHIRLYGVDAPERPHFGRQGQ PYGDEALEWLRSYILGRNVRVKLFSPDQYGRIVGGAKVWKLTGRKDVSTEMLKNGWGVKY EGKMGAEFNGKGKLFQKLEDHARKKKIGMFQQKGKIVTPGQYKKDE
Uniprot No.

Target Background

Database Links
Protein Families
LCL3 family
Subcellular Location
Mitochondrion. Membrane; Single-pass membrane protein.

Q&A

What is Yarrowia lipolytica and why is it significant for recombinant protein production?

Yarrowia lipolytica is an oleaginous yeast species that has emerged as a valuable host for recombinant protein production. It possesses the ability to efficiently degrade a wide range of hydrophobic substrates and produce numerous valuable metabolic products including proteins, peptides, amino acids, trace minerals, vitamins, and lipids . In recent years, it has become one of the most studied unicellular fungi after Saccharomyces cerevisiae due to its biotechnological potential .

Y. lipolytica has several advantages as a protein expression platform including efficient heterologous protein secretory capabilities and a growing set of genetic tools such as promoters, terminators, secretion markers, Golden Gate assembly, and CRISPR systems . Recent engineering efforts have focused on improving Y. lipolytica as an efficient protein-manufacturing platform by addressing issues like ER stress during protein overproduction, which often causes cell dysfunction .

What expression systems are optimal for producing recombinant Y. lipolytica proteins?

While Y. lipolytica itself serves as an excellent expression system for many heterologous proteins, recombinant Y. lipolytica proteins like LCL3 can be expressed in several different systems depending on research requirements:

  • E. coli expression system: As demonstrated with LCL3, E. coli provides a rapid and cost-effective platform for producing recombinant Y. lipolytica proteins . This system is advantageous for initial characterization studies but may lack some post-translational modifications found in the native host.

  • Native Y. lipolytica expression: For studies requiring authentic post-translational modifications and folding, expressing the protein in its native environment might be preferable. Y. lipolytica has an extensive set of genetic tools available for protein expression, including various promoters and terminators that can be selected based on expression requirements .

  • Other yeast expression systems: For comparative studies or when specific modifications are required, other yeast systems like Saccharomyces cerevisiae or Pichia pastoris might be considered.

When selecting an expression system, researchers should consider factors such as required yield, post-translational modifications, purification strategy, and downstream applications.

How should researchers approach experimental design when working with recombinant LCL3?

When designing experiments involving recombinant LCL3 from Y. lipolytica, researchers should consider:

  • Protein stability and storage: Recombinant LCL3 is typically provided as a lyophilized powder and should be stored at -20°C/-80°C upon receipt. Working aliquots can be maintained at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided .

  • Buffer selection: LCL3 is typically stored in Tris/PBS-based buffer with 6% Trehalose at pH 8.0, which should be considered when designing experimental conditions .

  • Reconstitution protocol: Briefly centrifuge the vial prior to opening to ensure all contents are at the bottom of the tube before reconstitution .

  • Purity considerations: Commercial preparations typically have >90% purity as determined by SDS-PAGE, which is sufficient for most applications but may require additional purification steps for certain sensitive assays .

  • Activity assays: As an endonuclease, assays should be designed to measure nucleic acid cleavage activity under various conditions to determine optimal pH, temperature, cofactor requirements, and substrate specificity.

  • Controls: Include appropriate positive and negative controls when characterizing enzymatic activity to account for potential contaminating nuclease activity in reagents.

What strategies can relieve ER stress during recombinant protein production in Y. lipolytica?

Endoplasmic reticulum (ER) stress is a significant challenge during recombinant protein overproduction in Y. lipolytica, as the accumulation of unfolded and misfolded proteins can cause cell dysfunction. Recent research has identified several strategies to address this issue:

  • Engineering ER chaperones: Studies have evaluated the effects of several potential ER chaperones on relieving ER stress by debottlenecking the protein synthetic machinery during production of both endogenous proteins (lipase 2) and heterologous proteins (E. coli proteins) .

  • Unfolded Protein Response (UPR) engineering: Upfront UPR combined with engineering of ER chaperones and translocation components has proven effective in relieving ER stress during recombinant protein production .

  • Maintaining cell viability: Engineered Y. lipolytica strains have demonstrated sustained maximum specific growth rates (μmax) of 0.38 h^-1 and biomass yields of 0.95 g-DCW/g-glucose, only slightly lower than wild-type strains, indicating the effectiveness of these approaches in maintaining cell viability during protein overproduction .

These strategies facilitate the development of Y. lipolytica as an efficient protein-manufacturing platform and could be applied when expressing challenging proteins like endonucleases that may induce cellular stress.

How does carbon source selection impact recombinant protein production in Y. lipolytica?

Y. lipolytica can metabolize various carbon sources, which can significantly impact recombinant protein production:

When producing recombinant proteins in Y. lipolytica, researchers should select the carbon source that not only supports optimal growth but also enhances the expression of the target protein. The choice may depend on the specific regulatory elements used in the expression construct and the metabolic pathways that are active under different substrate conditions.

What purification strategies are most effective for His-tagged recombinant proteins from Y. lipolytica?

Purification of His-tagged recombinant proteins like LCL3 typically follows these methodological steps:

  • Cell lysis optimization: For Y. lipolytica, which has a more robust cell wall than E. coli, optimization of lysis conditions is critical. Mechanical disruption methods (high-pressure homogenization, sonication, or bead-beating) are often required in combination with enzymatic approaches.

  • Immobilized Metal Affinity Chromatography (IMAC): The primary purification step for His-tagged proteins like LCL3 involves Ni-NTA or Co-NTA resins. Critical parameters to optimize include:

    • Imidazole concentration in binding and washing buffers

    • pH optimization (typically 7.4-8.0)

    • Salt concentration to reduce non-specific binding

    • Flow rate and contact time

  • Secondary purification: Depending on the required purity, additional chromatography steps may be necessary:

    • Ion exchange chromatography based on LCL3's theoretical isoelectric point

    • Size exclusion chromatography to separate aggregates or truncated forms

    • Hydrophobic interaction chromatography for additional selectivity

  • Quality assessment: SDS-PAGE analysis typically shows >90% purity for recombinant LCL3 , but additional assays like Western blotting (using anti-His antibodies) and mass spectrometry may be necessary to confirm identity and integrity.

  • Storage optimization: Recombinant LCL3 is typically stored as a lyophilized powder or in Tris/PBS-based buffer with 6% Trehalose at pH 8.0 . For long-term storage, aliquoting and storage at -20°C/-80°C is recommended to avoid freeze-thaw cycles.

What are the latest genetic engineering tools for improving recombinant protein expression in Y. lipolytica?

Recent advances in genetic engineering tools have significantly improved recombinant protein expression capabilities in Y. lipolytica:

  • Promoter and terminator systems: A suite of promoters and terminators with varying strengths and regulation patterns have been developed, allowing for fine-tuned expression control . These include:

    • Constitutive promoters of different strengths

    • Inducible promoters responsive to various stimuli

    • Hybrid promoters with enhanced activity

    • Pooled promoters for high-throughput screening

  • Secretion markers: Various secretion signals have been developed to facilitate extracellular protein production .

  • Golden Gate assembly: This modular cloning method has been adapted for Y. lipolytica, enabling rapid assembly of complex expression constructs .

  • CRISPR systems: Multiple CRISPR-Cas9 and CRISPR-Cas12 systems have been adapted for Y. lipolytica, enabling precise genome editing, multiplexed modifications, and transcriptional regulation .

  • ER stress reduction strategies: Engineering the unfolded protein response (UPR) combined with overexpression of ER chaperones has been shown to relieve ER stress during protein overproduction .

  • Metabolic engineering approaches: Engineering of relevant metabolic pathways has improved substrate utilization and protein production capacity. For example, engineering of xylose metabolism pathways has enabled growth on this alternative carbon source .

These tools can be combined to create optimized expression systems for recombinant proteins like LCL3, enhancing yields, quality, and functionality.

How can endonuclease activity be characterized and optimized in recombinant LCL3?

Characterization and optimization of endonuclease activity in recombinant LCL3 requires sophisticated methodological approaches:

  • Substrate specificity determination:

    • Analyze cleavage patterns using various DNA/RNA substrates (linear, circular, single-stranded, double-stranded)

    • Perform systematic sequence analysis to identify recognition motifs

    • Use high-throughput sequencing approaches to map cleavage sites genome-wide

  • Biochemical characterization:

    • Determine optimal reaction conditions (pH, temperature, ionic strength)

    • Identify cofactor requirements (divalent cations like Mg²⁺, Mn²⁺, Ca²⁺)

    • Measure kinetic parameters (K<sub>m</sub>, V<sub>max</sub>, k<sub>cat</sub>)

    • Assess inhibition patterns and mechanisms

  • Structure-function analysis:

    • Perform site-directed mutagenesis of conserved residues

    • Conduct structural studies (X-ray crystallography, cryo-EM, NMR)

    • Use computational modeling to predict substrate binding sites

  • Activity optimization:

    • Engineer variants with enhanced specificity, activity, or stability

    • Modify reaction conditions based on biochemical characterization

    • Explore the effects of protein modifications or additives on activity

  • Applications development:

    • Evaluate potential applications in molecular biology techniques

    • Assess feasibility for genome editing applications

    • Explore potential biotechnological applications

A systematic approach combining these methods will provide comprehensive insights into LCL3's enzymatic properties and guide optimization efforts for specific research applications.

What metabolic engineering approaches can improve Y. lipolytica as a host for LCL3 production?

Advanced metabolic engineering strategies can enhance Y. lipolytica's capacity for recombinant protein production, including proteins like LCL3:

  • Engineering ER homeostasis:

    • Overexpression of key ER chaperones that assist in protein folding

    • Engineering the unfolded protein response (UPR) to better manage ER stress

    • Optimization of translocation components to prevent bottlenecks in the secretory pathway

  • Carbon metabolism optimization:

    • Engineering of alternative substrate utilization pathways to enable growth on more economical carbon sources

    • Enhancement of substrate transport systems to improve uptake rates

    • Balancing carbon flux between growth and protein production

  • Redox and energy metabolism:

    • Engineering of redox cofactor regeneration systems

    • Optimization of energy metabolism to support protein synthesis demands

    • Balancing ATP production with protein synthesis requirements

  • Secretion pathway engineering:

    • Enhancement of vesicular transport systems

    • Optimization of post-translational modification machinery

    • Reduction of proteolytic degradation of secreted proteins

  • Genome-scale approaches:

    • Integration of omics data (transcriptomics, proteomics, metabolomics) to identify bottlenecks

    • Genome-scale modeling to predict optimal genetic modifications

    • Systems biology approaches to understand cellular responses to protein overproduction

The most effective strategy would likely combine multiple approaches, tailored to the specific challenges associated with LCL3 production. Monitoring key parameters such as growth rate, biomass yield, and protein production throughout strain development is crucial for successful optimization .

How do post-translational modifications in Y. lipolytica impact recombinant endonuclease function?

Post-translational modifications (PTMs) in Y. lipolytica can significantly impact the structure, stability, and function of recombinant endonucleases like LCL3:

  • Glycosylation patterns:

    • Y. lipolytica produces mannose-rich N-glycans that differ from those in other expression systems

    • The ylMpo1 gene in Y. lipolytica efficiently catalyzes mannophosphorylation in a single step, whereas this is a two-step process in S. cerevisiae

    • These unique glycosylation patterns may affect protein stability, solubility, and immunogenicity

  • Disulfide bond formation:

    • Proper disulfide bond formation is critical for the tertiary structure of many endonucleases

    • Y. lipolytica possesses an efficient machinery for disulfide bond formation in the ER

    • The oxidative environment of the ER and the presence of disulfide isomerases contribute to correct folding

  • Proteolytic processing:

    • Signal peptide cleavage and potential processing of pro-regions can affect enzyme activity

    • Y. lipolytica possesses various proteases that may process recombinant proteins differently than other hosts

  • Other modifications:

    • Phosphorylation, acetylation, and other PTMs may occur differently in Y. lipolytica compared to other expression systems

    • These modifications can affect enzyme kinetics, substrate recognition, and stability

  • Methodological approaches for PTM analysis:

    • Mass spectrometry-based glycoproteomics and proteomics

    • Enzymatic deglycosylation assays to assess glycosylation impact

    • Comparative activity assays between proteins expressed in different systems

    • Mutation of potential modification sites to assess their importance

Understanding and potentially engineering these PTMs can help optimize recombinant endonuclease production in Y. lipolytica for specific research applications.

What are the most sensitive analytical methods for assessing recombinant endonuclease LCL3 activity?

Advanced analytical methods for characterizing LCL3 endonuclease activity include:

  • Gel-based assays:

    • Agarose gel electrophoresis for analyzing DNA fragmentation patterns

    • Denaturing polyacrylamide gel electrophoresis for precise mapping of cut sites

    • Pulsed-field gel electrophoresis for analysis of large DNA fragments

  • Fluorescence-based assays:

    • Real-time monitoring using fluorescently labeled substrates

    • Fluorescence resonance energy transfer (FRET)-based assays for continuous monitoring

    • High-throughput microplate assays with fluorescence readout

  • Next-generation sequencing approaches:

    • Sequencing of cleavage products to identify cut sites with single-nucleotide resolution

    • ChIP-seq derived methods to identify genome-wide binding and cleavage sites

    • RNA-seq to assess RNA substrate specificity

  • Biophysical methods:

    • Surface plasmon resonance (SPR) to study enzyme-substrate binding kinetics

    • Isothermal titration calorimetry (ITC) for thermodynamic characterization

    • Microscale thermophoresis for binding affinity determination

  • Single-molecule techniques:

    • Atomic force microscopy to visualize DNA-enzyme interactions

    • Single-molecule FRET to monitor conformational changes during catalysis

    • Optical tweezers to study mechanical aspects of DNA cleavage

  • Mass spectrometry approaches:

    • MALDI-TOF analysis of cleavage products

    • LC-MS/MS for detailed characterization of complex substrate mixtures

    • Hydrogen-deuterium exchange mass spectrometry to probe structural dynamics

  • Computational analysis:

    • Sequence motif identification from experimental cleavage data

    • Molecular dynamics simulations to understand enzyme-substrate interactions

    • Machine learning approaches to predict cleavage sites and efficiency

These advanced analytical methods, used in combination, can provide comprehensive insights into the catalytic mechanism, substrate specificity, and potential applications of recombinant LCL3 endonuclease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.