Recombinant Yarrowia lipolytica Protein YOP1 (YOP1)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of YOP1

YOP1 is cataloged as a recombinant protein available for research purposes, produced in Y. lipolytica (Creative BioMart ). While its specific biological role in this yeast remains uncharacterized in the provided literature, homologous proteins in other fungi (e.g., Saccharomyces cerevisiae) suggest potential involvement in membrane protein interactions or endoplasmic reticulum (ER) dynamics.

Key Features:

  • Expression System: Engineered using Y. lipolytica's efficient secretion machinery, which favors co-translational translocation into the ER—a critical advantage over other yeasts like S. cerevisiae .

  • Tagging: Available with a His-tag for purification and detection .

Biotechnological Context of YOP1 Production

Y. lipolytica is renowned for its ability to synthesize and secrete complex heterologous proteins, attributed to:

  • Co-translational secretion pathways, enabling proper folding of large proteins .

  • Engineered promoters and transcription factors (TFs) that enhance recombinant protein yields. For example, hybrid TEF promoters with upstream activating sequences (UAS) boost expression levels by 2–4× .

Table 1: Factors Influencing Recombinant Protein Yields in Y. lipolytica

FactorImpact on YOP1-like Protein ProductionSource
Promoter Strength8× UAS-TEF increases mRNA/protein levels
ER ChaperonesOverexpression of Kar2p/Sls1p improves lipase activity by 50%
Transcription FactorsGzf1/Hsf1 act as universal enhancers of protein synthesis

Potential Applications

While YOP1-specific applications are not detailed, Y. lipolytica's recombinant proteins are utilized in:

  • Industrial biotechnology: Single-cell oil production, waste valorization, and enzyme synthesis .

  • Aquaculture: As a sustainable protein source in shrimp feed, improving growth and antioxidant parameters .

Research Gaps and Future Directions

  • Functional Characterization: No studies directly address YOP1’s role in Y. lipolytica’s metabolism or secretion pathways.

  • Optimization Strategies: Leveraging TF engineering (e.g., Yap-like or Hsf1 overexpression) could enhance YOP1 yields under stress conditions .

Table 2: Proposed Engineering Targets for YOP1 Optimization

ApproachExpected OutcomeRationale
Co-expression with Sls1p/Kar2pImproved folding/secretion efficiency
Hybrid PromotersIncreased transcriptional activity
Diploid Strain EngineeringMulti-copy integration for higher yields

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can accommodate specific format requirements. Please indicate your preference when placing the order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is preferred, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, briefly centrifuge the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can serve as a reference point.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms can be stored for up to 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize the development of your specified tag.
Synonyms
YOP1; YALI0B19668g; Protein YOP1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
full length protein
Species
Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica)
Target Names
YOP1
Target Protein Sequence
MSQIIDQVQAALQNIDKELEKYPALKELEKQIPVPKSYILLGFVGFYFILIFLNIGGIGQ LLSNIAGLVIPGYYSLLALETPGKADDTQYLTYWVVFATLNVFEFWSKAILYWVPFYYLF KTAFLLYIGLPQYGGAELVYKAIVKPLAQKLVNIQPHGGPSDSLKAQAQSAVDAAESHVP QGHSTGVSH
Uniprot No.

Target Background

Function
YOP1 is involved in membrane/vesicle trafficking.
Database Links
Protein Families
DP1 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Yarrowia lipolytica and why is it significant as a model organism?

Yarrowia lipolytica is an obligate aerobic, non-conventional yeast that has emerged as a powerful model organism for both laboratory studies and industrial applications. This yeast is particularly valuable due to the availability of its genome sequence and established genetic tools for gene manipulation . Y. lipolytica can efficiently utilize diverse carbon sources including alkanes, fatty acids, ethanol, acetate, glucose, fructose, and glycerol, making it versatile for various experimental setups . As an oleaginous yeast, it possesses the remarkable ability to accumulate more than 40% lipid content of its biomass under certain conditions, which has attracted significant interest for biofuel applications . Its unique respiratory chain contains complexes I-IV, an "alternative" NADH-dehydrogenase (NDH2), and a non-heme alternative oxidase (AOX), providing opportunities for studying mitochondrial function and energy metabolism .

How does nitrogen limitation affect Y. lipolytica metabolism and protein expression?

Nitrogen limitation significantly impacts Y. lipolytica metabolism by inhibiting cell growth while simultaneously promoting lipid accumulation. Experimental evidence demonstrates that under nitrogen-limited conditions, lipid content increases from 8.7% to 14.3% of biomass . This metabolic shift occurs through specific pathway modulations rather than global changes. Most notably, nitrogen limitation significantly increases flux through ATP:citrate lyase (ACL), which plays a key role in providing acetyl-CoA for lipid accumulation . Unlike some assumptions, metabolic flux analysis has shown that the pentose phosphate pathway is not significantly regulated by nitrogen concentration, suggesting that NADPH generation is not the limiting factor for lipid accumulation in Y. lipolytica . These metabolic shifts under nitrogen limitation can affect recombinant protein expression systems and must be carefully considered when designing experimental protocols.

What are the essential genetic tools available for Y. lipolytica manipulation?

Y. lipolytica has a robust set of genetic tools that facilitate protein expression studies:

  • Deletion strains and complementation systems: Researchers have successfully developed deletion strains for several proteins that can be complemented by shuttle plasmids carrying the deleted gene .

  • Protein tagging systems: Affinity tags such as hexa-histidine can be attached to proteins (demonstrated with the NUGM subunit), allowing fast and efficient purification by affinity chromatography .

  • Site-directed mutagenesis tools: Well-established tools for site-directed mutagenesis enable identification of functionally important amino acids in proteins of interest .

  • Redirected targeting sequences: Sophisticated approaches like attaching targeting sequences can redirect proteins to different cellular compartments, as demonstrated with NDH2 being redirected to the mitochondrial matrix .

  • Transcription factor engineering systems: Methods for overexpression (OE) or deletion (KO) of transcription factors allow manipulation of complex biological traits .

How do specific transcription factors influence recombinant protein synthesis in Y. lipolytica?

Transcription factors (TFs) play critical roles in orchestrating recombinant protein synthesis in Y. lipolytica through complex regulatory networks. A systematic study of five transcription factors—HSF1 (YALI0E13948g), GZF1 (YALI0D20482g), CRF1 (YALI0B08206g), SKN7 (YALI0D14520g), and YAP-like (YALI0D07744g)—revealed their distinct functions in stress response and recombinant protein production .

Among these, GZF1 and HSF1 were identified as universal enhancers of recombinant protein production in Y. lipolytica, with their overexpression significantly increasing protein yields across various environmental conditions . Other transcription factors showed condition-specific effects. For example, the YAP-like transcription factor was shown to alleviate growth retardation under high pH conditions . The following table summarizes key TF functions:

Transcription FactorGene IDPrimary FunctionEffect on Recombinant Protein Production
HSF1YALI0E13948gStress response, osmostress responseUniversal enhancer of r-Prot synthesis
GZF1YALI0D20482gTranscriptional regulationUniversal enhancer of r-Prot synthesis
CRF1YALI0B08206gStress responseCondition-dependent effects
SKN7YALI0D14520gOsmostress responseDeletion disables growth under hyperosmotic stress
YAP-likeYALI0D07744gpH-dependent activityAlleviates growth retardation under high pH

This research demonstrates that engineering transcription factors offers a powerful approach for manipulating complex traits like recombinant protein production in Y. lipolytica .

What methodologies are recommended for metabolic flux analysis in Y. lipolytica?

Metabolic flux analysis provides critical insights into the in vivo activities of central carbon metabolic pathways in Y. lipolytica. For robust metabolic flux analysis, the following methodology is recommended:

  • Isotopic labeling: Utilize 13C-labeled glucose as a sole carbon source to track carbon flow through metabolic pathways . The labeled glucose provides traceable carbon atoms that can be followed through various metabolic intermediates.

  • Controlled cultivation conditions: Perform experiments under both nitrogen-sufficient and nitrogen-limited conditions to compare metabolic flux distributions under different physiological states .

  • Analytical techniques: Employ gas chromatography-mass spectrometry (GC-MS) to analyze the isotopic enrichment patterns of metabolic intermediates and end products .

  • Flux calculation and modeling: Apply mathematical models to calculate metabolic fluxes based on isotopomer distribution patterns of key metabolites .

  • Validation experiments: Conduct enzyme activity assays to validate the flux analysis results, particularly for key enzymes such as ATP:citrate lyase (ACL) and malic enzyme .

This approach has successfully revealed that in Y. lipolytica, the pentose phosphate pathway flux is not significantly regulated by nitrogen concentration, and that the flux through malic enzyme is undetectable, confirming its non-regulatory role in lipid accumulation .

How does the respiratory chain in Y. lipolytica affect recombinant protein production?

The respiratory chain of Y. lipolytica possesses unique characteristics that influence recombinant protein production. Unlike conventional yeasts, Y. lipolytica is an obligate aerobe with a respiratory chain containing complexes I-IV, an "alternative" NADH-dehydrogenase (NDH2), and a non-heme alternative oxidase (AOX) .

This respiratory configuration has several implications for recombinant protein production:

  • Energy metabolism: Complex I is essential in Y. lipolytica because the NADH binding site of NDH2 faces the mitochondrial intermembrane space rather than the matrix . This configuration affects energy generation and redox balance, which can impact protein synthesis.

  • Oxygen dependency: As an obligate aerobe, Y. lipolytica requires oxygen for growth, making oxygen availability a critical parameter for optimizing recombinant protein production .

  • Stress response connection: The respiratory chain is interconnected with stress response mechanisms. Phenotype screening under different oxygen availability conditions showed that transcription factors like HSF1 and GZF1 can influence both stress resistance and recombinant protein synthesis .

  • Metabolic engineering potential: The unique respiratory chain allows for specific engineering approaches, such as redirecting NDH2 to the matrix side by attaching targeting sequences, which can be leveraged to enhance recombinant protein production .

Researchers have demonstrated that recombinant protein yields can be significantly increased or decreased due to engineering of transcription factors that affect respiratory function and stress response .

What environmental conditions should be optimized for maximum YOP1 expression in Y. lipolytica?

To maximize YOP1 expression in Y. lipolytica, several environmental parameters must be carefully optimized based on phenotype screening studies:

  • pH: pH significantly affects protein expression in Y. lipolytica, with YAP-like transcription factor activity being particularly pH-dependent . Experiments should test a range of pH values (typically pH 4.0-8.0) to determine optimal conditions for YOP1 expression.

  • Oxygen availability: As an obligate aerobe, Y. lipolytica's growth and protein expression are highly dependent on oxygen availability . Different aeration rates should be tested to identify optimal conditions.

  • Temperature: Temperature affects both growth and recombinant protein yields. Phenotype screening under different temperatures helps identify the optimal temperature range for YOP1 expression .

  • Osmolality: Hyperosmotic stress can significantly impact growth, especially in strains with KO of SKN7 and HSF1 transcription factors . The osmotic pressure of the medium should be optimized to balance growth and protein expression.

  • Nitrogen concentration: Nitrogen limitation promotes lipid accumulation but inhibits cell growth . The optimal nitrogen concentration should balance biomass production with protein expression efficiency.

Mathematical modeling of these parameters can help identify optimal conditions and their interactions. For instance, research has shown that environmental factors can "awaken" individual transcription factors, whose contributions can be mathematically described to predict protein production under specific conditions .

How can transcription factor engineering be implemented to enhance YOP1 yields?

Implementing transcription factor engineering to enhance YOP1 yields involves several strategic steps:

  • Selection of appropriate transcription factors: Based on research findings, GZF1 (YALI0D20482g) and HSF1 (YALI0E13948g) are universal enhancers of recombinant protein production in Y. lipolytica and should be primary targets for engineering .

  • Overexpression strategy: Construct overexpression vectors containing the selected transcription factor genes under the control of constitutive or inducible promoters. The overexpression (OE) approach has been shown to significantly increase recombinant protein yields under specific conditions .

  • Host strain preparation: Use a host strain already expressing the reporter recombinant protein (YOP1) to evaluate the impact of transcription factor modifications .

  • Phenotype screening under different conditions: Subject the engineered strains to phenotype screening under various environmental conditions (pH, oxygen availability, temperature, and osmolality) to identify optimal production conditions .

  • Validation and optimization: Quantify YOP1 yields using appropriate analytical methods and optimize the expression system based on the results.

  • Mathematical modeling: Apply mathematical modeling to the obtained data to describe the contribution of each transcription factor under specific environmental conditions .

This approach has been demonstrated to significantly increase recombinant protein yields in Y. lipolytica by modifying the operation of transcription factors associated with complex traits like stress resistance and protein synthesis .

What purification strategies are most effective for recombinant proteins from Y. lipolytica?

Effective purification of recombinant proteins from Y. lipolytica requires specialized approaches:

  • Affinity tag integration: Attaching a hexa-histidine tag to the recombinant protein enables fast and efficient purification by affinity chromatography. This approach has been successfully demonstrated with the NUGM (30 kDa) subunit of complex I in Y. lipolytica .

  • Lipid considerations: Purified proteins from Y. lipolytica may lose activity due to removal of essential lipids. Research has shown that purified complex I lost most of its NADH:ubiquinone oxidoreductase activity but was almost fully reactivated by adding 400-500 molecules of phosphatidylcholine per complex . Therefore, lipid reactivation should be considered for optimal protein activity.

  • Secretion systems: When possible, designing the expression system to secrete the protein into the medium can facilitate purification by eliminating the need for cell disruption and reducing contamination with intracellular proteins.

  • Chromatographic sequence optimization: A typical purification protocol might include:

    • Initial capture using affinity chromatography (if tagged)

    • Intermediate purification using ion exchange chromatography

    • Polishing step using size exclusion chromatography

  • Scale considerations: Laboratory-scale purification protocols should be designed with potential scalability in mind, particularly regarding buffer compositions and chromatographic methods.

The most suitable purification strategy will depend on the specific properties of the target protein, including its size, charge, hydrophobicity, and intended downstream applications.

How should growth and protein production data be analyzed to identify rate-limiting steps?

Proper analysis of growth and protein production data requires a systematic approach to identify rate-limiting steps:

  • Growth kinetics analysis: Plot growth curves (biomass vs. time) and calculate specific growth rates (μ) under different conditions. Analyze how genetic modifications and environmental factors affect growth patterns .

  • Protein production profiles: Track recombinant protein yields over time and calculate specific production rates (qp). Compare these rates under different conditions to identify patterns .

  • Yield coefficients calculation: Determine yield coefficients such as Yp/x (protein produced per unit biomass) and Yp/s (protein produced per unit substrate) to assess process efficiency .

  • Correlation analysis: Perform correlation analysis between growth parameters, protein production, and environmental factors to identify significant relationships .

  • Mathematical modeling: Develop mathematical models that describe the relationships between transcription factor activity, environmental conditions, and recombinant protein production . These models can help predict optimal conditions and identify rate-limiting steps.

  • Metabolic flux analysis: Use metabolic flux analysis to identify bottlenecks in carbon flow that may limit protein production .

For example, research has shown that overexpression of GZF1 and HSF1 transcription factors significantly enhances recombinant protein production, suggesting that transcriptional regulation may be a rate-limiting step in Y. lipolytica . Similarly, nitrogen limitation significantly increases flux through ATP:citrate lyase (ACL), indicating that acetyl-CoA provision can be rate-limiting under certain conditions .

What approaches can address contradictory results between transcriptomic and metabolic flux data?

When facing contradictory results between transcriptomic and metabolic flux data in Y. lipolytica research, consider these methodological approaches:

  • Integration of multiple data types: Combine transcriptomic, proteomic, and metabolomic data to create a more comprehensive picture. For instance, while transcriptomic data might suggest upregulation of malic enzyme in Y. lipolytica under certain conditions, metabolic flux analysis revealed undetectable flux through this enzyme, confirming its non-regulatory role in lipid accumulation .

  • Time-course analysis: Collect data at multiple time points to capture the dynamic nature of cellular responses. Transcriptional changes often precede metabolic flux changes, which may explain apparent contradictions in snapshot data.

  • Post-transcriptional regulation assessment: Investigate post-transcriptional regulatory mechanisms that might explain discrepancies between transcript levels and metabolic fluxes. For example, while a gene may be transcribed, the protein might be inactive due to post-translational modifications.

  • Enzyme kinetics studies: Conduct enzyme activity assays to determine if transcriptional changes translate to functional changes in enzyme activity.

  • Flux control coefficient determination: Calculate flux control coefficients to quantify the degree to which each enzyme controls the flux through a pathway, which may not correlate directly with transcript levels.

  • Statistical validation: Apply rigorous statistical methods to determine if apparent contradictions are statistically significant or within the margin of error of the experimental techniques.

A concrete example from Y. lipolytica research demonstrates this approach: while previous studies suggested malic enzyme plays a key role in lipid accumulation in some oleaginous fungi, metabolic flux analysis in Y. lipolytica showed undetectable flux through this enzyme, contradicting transcriptomic predictions but confirming biochemical analyses showing lack of NADP+-dependent activity .

How can low recombinant protein yields be diagnosed and addressed in Y. lipolytica?

Diagnosing and addressing low recombinant protein yields in Y. lipolytica requires a systematic approach:

  • Transcription factor analysis: Low yields may result from suboptimal transcription factor activity. Research has shown that overexpression of GZF1 and HSF1 transcription factors can significantly enhance recombinant protein production in Y. lipolytica . Consider engineering these factors to improve expression.

  • Environmental stress assessment: Subject the culture to phenotype screening under different environmental conditions (pH, oxygen availability, temperature, and osmolality) to identify potential stressors limiting protein production . For instance, YAP-like transcription factor activity is pH-dependent, and its overexpression can alleviate growth retardation under high pH .

  • Energy metabolism evaluation: Complex I is essential in Y. lipolytica due to its unique respiratory chain configuration . Ensure adequate oxygen supply and monitor energy metabolism markers to identify potential limitations in energy provision for protein synthesis.

  • Nitrogen balance optimization: Nitrogen limitation promotes lipid accumulation but inhibits cell growth . Find the optimal nitrogen concentration that balances biomass production with protein expression efficiency.

  • Codon optimization: Analyze the coding sequence for rare codons that might limit translation efficiency and consider codon optimization for Y. lipolytica.

  • Secretion pathway analysis: If the protein is secreted, examine the secretion pathway for bottlenecks. Consider co-expressing chaperones or other folding assistants to improve secretion efficiency.

  • Protein stability assessment: Evaluate protein stability in the production environment. If necessary, engineer the protein or expression conditions to enhance stability.

By systematically addressing these potential limitations, researchers can significantly improve recombinant protein yields in Y. lipolytica expression systems.

What strategies can mitigate stress-induced decreases in protein production?

Mitigating stress-induced decreases in protein production in Y. lipolytica requires targeted approaches based on the specific stress factors:

  • Transcription factor engineering: Overexpress specific transcription factors that enhance stress resistance and protein production:

    • HSF1 has been shown to act in osmostress response

    • SKN7 plays a crucial role in hyperosmotic stress resistance

    • YAP-like transcription factor alleviates growth retardation under high pH

  • Environmental parameter optimization: Mathematically model the contribution of environmental factors to identify optimal conditions that minimize stress while maximizing protein production . Research has demonstrated that growth and recombinant protein yields under specific conditions can be significantly increased or decreased due to transcription factor engineering .

  • Gradual adaptation strategies: Gradually adapt cultures to stress conditions rather than subjecting them to sudden changes. This allows cells to activate appropriate stress response mechanisms without severely compromising protein production.

  • Fed-batch or continuous cultivation: Implement fed-batch or continuous cultivation strategies to maintain cells in a physiological state that balances stress resistance and protein production.

  • Medium supplementation: Add specific compounds that enhance stress resistance, such as compatible solutes for osmotic stress or antioxidants for oxidative stress.

  • Heat shock preconditioning: Apply mild heat shock before introducing other stressors to activate the general stress response and increase cellular resistance to subsequent stress.

Research has shown that deletion (KO) of SKN7 and HSF1 disabled growth under hyperosmotic stress, highlighting their importance in stress resistance . Conversely, overexpression of these factors can enhance both stress resistance and recombinant protein production .

What are the emerging approaches for enhancing recombinant protein production in Y. lipolytica?

Several emerging approaches show promise for enhancing recombinant protein production in Y. lipolytica:

  • Integrated multi-omics approaches: Combining transcriptomics, proteomics, metabolomics, and fluxomics data provides comprehensive insights into the molecular mechanisms underlying recombinant protein production . Recent studies have begun to apply these approaches to broaden our understanding of Y. lipolytica biology .

  • Synthetic biology tools: Development of standardized genetic parts, modular expression systems, and genome-scale engineering tools for Y. lipolytica enables more precise and efficient strain engineering.

  • CRISPR-Cas9 applications: Adaptation of CRISPR-Cas9 technology for Y. lipolytica allows for rapid and precise genetic modifications, including multiplex editing and transcriptional regulation.

  • Systems biology modeling: Mathematical modeling of metabolism and protein production pathways enables prediction of optimal engineering strategies and culture conditions .

  • Metabolic engineering for enhanced energy supply: Engineering approaches that optimize the unique respiratory chain of Y. lipolytica, including its obligate aerobic nature and essential complex I , can improve energy supply for protein synthesis.

  • Transcription factor combinatorial engineering: While individual transcription factors like GZF1 and HSF1 have been identified as universal enhancers of recombinant protein production , combinatorial engineering of multiple transcription factors may yield synergistic improvements.

  • Adaptive laboratory evolution: Applying directed evolution approaches to adapt Y. lipolytica to specific production conditions or to enhance protein expression capabilities.

These emerging approaches leverage the unique biology of Y. lipolytica, including its oleaginous nature, obligate aerobic metabolism, and adaptability to various carbon sources and environmental conditions, to develop more efficient recombinant protein production systems.

How might advances in metabolic engineering enhance YOP1 production in Y. lipolytica?

Recent advances in metabolic engineering offer promising strategies to enhance YOP1 production in Y. lipolytica:

These metabolic engineering approaches can be integrated with transcription factor engineering, as GZF1 and HSF1 have been identified as universal enhancers of recombinant protein production in Y. lipolytica , potentially leading to synergistic improvements in YOP1 production.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.