Recombinant Yarrowia lipolytica Protoheme IX farnesyltransferase, mitochondrial (COX10)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate your specific format requests. Please include any such preferences in your order notes, and we will do our best to fulfill them.
Lead Time
Delivery times can vary depending on the purchase method and location. For precise delivery estimates, please consult your local distributors.
Note: All protein shipments are standardly packed with blue ice packs. If dry ice packaging is required, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing should be avoided. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
The shelf life of a product is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
COX10; YALI0F23727g; Protoheme IX farnesyltransferase, mitochondrial; Heme O synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
61-471
Protein Length
full length protein
Species
Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica)
Target Names
Target Protein Sequence
PFALSNTNSATTAPLQFLSNVSLCRVTPGTITTSAKATAPNLDKMSAEAATTAAQASASP VEDSFLKKAVSCQSETEREAVMAARAAKKALRETKETWWAPYVALTKPRLTVLVVLSAMS SYALTPEAVSLTNLLFLTVGTALCSGSANAINMGREPAYDSMMTRTRGRPVVRGAVTPNQ AFTFAGITGTVGTAALYFGVNPTVAILGASNIALYGGLYTTLKRKHIINTWVGAVVGAIP PLMGWAASGGSLLHPGAWCLAGLLYAWQFPHFNALSYSIRDEYKKAGYVMTAWKNPGLNA RVGLRYALLMFPLCVGLSYYNVTDWWFVLDSSVLNAWMAWWAFKFWQQENVNIALAAAGK QYSQNPFARKLFWGSVVHLPGVLLLAMIHKKGQWDWLFGPSEDEKKKTLSS
Uniprot No.

Target Background

Function
This enzyme catalyzes the conversion of protoheme IX and farnesyl diphosphate to heme O.
Database Links
Protein Families
UbiA prenyltransferase family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is Protoheme IX Farnesyltransferase (COX10) and what is its function in Yarrowia lipolytica?

Protoheme IX farnesyltransferase (COX10) is a mitochondrial enzyme that catalyzes a critical step in the heme biosynthetic pathway. In Yarrowia lipolytica, as in other organisms, COX10 is responsible for converting protoheme IX (heme B) to heme O by attaching a farnesyl group. This process is essential for the electron transport chain functionality, as heme serves as an electron acceptor in mitochondrial respiration . The gene encoding COX10 in Y. lipolytica is annotated as YALI0F23727g. The enzyme plays a crucial role in cellular respiration and energy metabolism, making it fundamental to Y. lipolytica's growth characteristics and metabolic capabilities .

The full-length COX10 protein in Y. lipolytica spans amino acids 61-471 and contains multiple transmembrane domains characteristic of mitochondrial membrane proteins . Research has demonstrated that proper functioning of COX10 is integral to optimal growth rates and metabolic efficiency, particularly in engineered strains designed for biotechnological applications .

How is recombinant Y. lipolytica COX10 typically expressed and purified for research applications?

Recombinant Y. lipolytica COX10 is commonly expressed in E. coli expression systems using codon-optimized constructs. For efficient expression and purification, the protein is typically tagged with a His-tag at the N-terminus, which facilitates single-step affinity chromatography purification . The standard expression protocol involves:

  • Transformation of expression vector containing the COX10 coding sequence (amino acids 61-471) into an appropriate E. coli strain

  • Induction of protein expression under optimized conditions

  • Cell lysis under conditions that preserve protein integrity

  • Affinity purification using Ni-NTA or similar matrix

  • Final purification steps may include size exclusion chromatography

The purified protein is typically obtained as a lyophilized powder with purity greater than 90% as determined by SDS-PAGE analysis . For research applications requiring active enzyme, careful refolding and reconstitution protocols must be followed to ensure proper membrane protein conformation.

What are the optimal storage and handling conditions for recombinant Y. lipolytica COX10?

Recombinant Y. lipolytica COX10 requires specific storage and handling conditions to maintain stability and functionality. The optimal conditions include:

ParameterRecommended ConditionNotes
Storage temperature-20°C to -80°C for long-termAliquoting is necessary to avoid repeated freeze-thaw cycles
Working storage4°CFor up to one week
Buffer compositionTris/PBS-based buffer, pH 8.0With 6% trehalose as stabilizer
ReconstitutionDeionized sterile waterTo concentration of 0.1-1.0 mg/mL
Cryoprotectant5-50% glycerol (final concentration)50% is the default recommendation

It is important to avoid repeated freeze-thaw cycles as this significantly reduces enzyme activity . For optimal results, the protein should be briefly centrifuged prior to opening to bring contents to the bottom of the vial. When working with the reconstituted protein, researchers should minimize exposure to extreme pH or temperature conditions that could denature the membrane protein.

What genetic engineering approaches are most effective for manipulating COX10 expression in Y. lipolytica?

Genetic manipulation of COX10 in Y. lipolytica requires specialized approaches due to this yeast's preference for non-homologous end-joining (NHEJ) over homologous recombination (HR). Research has demonstrated several effective strategies:

  • Enhanced Homologous Recombination: Disruption of the ku70 gene, which is responsible for double-strand break repair in the NHEJ pathway, significantly improves HR efficiency. When combined with cell cycle synchronization to S-phase using hydroxyurea, HR frequency can exceed 46% even with short homology regions (50 bp) .

  • Cre/lox System: A novel genetic tool based on the Cre/lox site-specific recombination system enables targeted, repeated, and markerless gene integration in Y. lipolytica. This approach requires only a single selection marker and can completely excise unnecessary sequences, allowing for multiple rounds of genetic modification .

  • Expression Optimization: For controlled expression of COX10, promoter selection is critical. Strong constitutive promoters such as TEF or inducible promoters like EYK1 can be employed depending on the experimental requirements.

The integration of COX10 variants can be achieved with high precision (>53% correct integration) when using optimized homology regions and appropriate selection markers . This efficiency is crucial when creating strains with modified COX10 functionality for metabolic engineering applications.

How does COX10 functionality impact mitochondrial metabolism and cellular energetics in Y. lipolytica?

COX10 functionality has profound effects on mitochondrial metabolism and cellular energetics in Y. lipolytica through its role in heme biosynthesis and electron transport chain function. Research findings indicate:

  • Electron Transport Chain Integrity: COX10 is essential for producing heme O, which serves as an electron acceptor in the electron transport chain. Disruption or modification of COX10 activity directly affects the efficiency of oxidative phosphorylation and ATP production .

  • Metabolic Reprogramming: Studies in other organisms have shown that alterations in COX10 activity can induce feedback inhibition of metabolic pathways, particularly suppressing the TCA cycle . In Y. lipolytica, which has robust lipid metabolism, COX10 functionality likely influences the balance between fermentation and respiration.

  • Growth Rate Correlation: Engineered Y. lipolytica strains with enhanced metabolic efficiency show improved growth rates (specific growth rate of 0.32 h⁻¹, 54% greater than wild-type strains) . While not directly studied, COX10 optimization could contribute to these improved growth characteristics through enhanced respiratory efficiency.

  • Lipid Metabolism Interface: Y. lipolytica's ability to accumulate lipids (up to 67.66% of dry cell weight in engineered strains) is intrinsically linked to mitochondrial function and energy metabolism, suggesting COX10 may play an indirect but significant role in the cell's lipogenic capacity.

What experimental approaches can be used to assess COX10 enzyme activity in vitro and in vivo?

Assessing COX10 enzyme activity requires specialized techniques due to its membrane-associated nature and complex function. Recommended approaches include:

In vitro assessment methods:

  • Radioisotope-based assay: Using ¹⁴C-labeled farnesyl pyrophosphate as substrate and measuring the conversion of protoheme IX to heme O via thin-layer chromatography or HPLC.

  • HPLC analysis: Quantification of heme O formation using reverse-phase HPLC with appropriate standards.

  • Spectrophotometric analysis: Measuring changes in absorption spectra during the conversion of protoheme IX to heme O.

In vivo assessment methods:

  • Respiratory capacity measurement: Oxygen consumption rate analysis using respirometry to assess the functional impact of COX10 variants on electron transport chain activity.

  • Growth phenotyping: Systematic analysis of growth rates under different carbon sources and oxygen conditions to evaluate the impact of COX10 modifications on cellular metabolism.

  • Heme quantification: Extraction and quantification of different heme species from Y. lipolytica cells to determine the relative abundance of heme O versus other heme types.

  • Reporter systems: Development of fluorescent or luminescent reporter systems linked to cellular responses to respiratory efficiency.

When designing experiments to assess COX10 activity, researchers should consider the potential confounding factors such as substrate availability, membrane integrity, and cellular redox state, which can all influence the measured enzyme activity.

How does COX10 function in Y. lipolytica compare to homologous proteins in other yeast species?

COX10 function in Y. lipolytica shares fundamental similarities with homologous proteins in other yeasts but also exhibits distinct characteristics reflecting Y. lipolytica's unique metabolism:

CharacteristicY. lipolytica COX10S. cerevisiae COX10Other Yeasts
Protein length411 amino acids (residues 61-471) 443 amino acidsVariable
Subcellular localizationMitochondrial membraneMitochondrial membraneMitochondrial membrane
Metabolic contextOleaginous yeast with high lipid accumulation capacityFermentative preferenceSpecies-dependent
RegulationLikely regulated in coordination with lipid metabolismRegulated in response to oxygen availabilityVaries by species
Impact on respirationCritical for respiratory growth and lipid metabolismEssential for respiratory growthEssential for respiratory growth

Unlike Saccharomyces cerevisiae, which can survive with defective respiratory function due to its fermentative capabilities, Y. lipolytica is an obligate aerobe with greater dependence on functional mitochondrial respiration. This suggests that COX10 functionality may be even more critical in Y. lipolytica .

The amino acid sequence of Y. lipolytica COX10 shows conserved functional domains across yeast species, but with specific variations that may reflect adaptations to Y. lipolytica's distinct metabolic preferences, particularly its superior ability to utilize hydrophobic substrates and accumulate lipids .

What role might COX10 play in the context of metabolic engineering of Y. lipolytica for biotechnological applications?

COX10 presents several potential leverage points for metabolic engineering of Y. lipolytica in biotechnology applications:

When incorporating COX10 modifications into metabolic engineering strategies, researchers should consider the complex interplay between respiratory function, central carbon metabolism, and product-specific biosynthetic pathways.

What are the primary challenges in expressing and studying membrane-bound proteins like COX10 from Y. lipolytica?

Expressing and studying membrane-bound proteins such as COX10 from Y. lipolytica presents several significant challenges:

  • Heterologous expression difficulties: Membrane proteins typically have hydrophobic domains that can cause aggregation and misfolding when expressed in heterologous systems. The current expression system using E. coli may not fully recapitulate the native folding environment, potentially affecting protein function.

  • Purification challenges: Extracting membrane proteins while maintaining their native conformation requires specialized detergents and buffer conditions. Finding the optimal solubilization and purification strategy for Y. lipolytica COX10 that preserves its structure and activity remains challenging.

  • Activity reconstitution: After purification, reconstituting membrane proteins into artificial membrane systems that support their native activity is technically demanding and requires optimization of lipid composition, protein-to-lipid ratios, and buffer conditions.

  • Structural characterization limitations: Obtaining high-resolution structural data for membrane proteins is generally more difficult than for soluble proteins, limiting detailed structure-function analysis of COX10.

  • In vivo analysis complexities: Studying COX10 function in its native cellular environment is complicated by the interconnectedness of mitochondrial functions and the potential pleiotropic effects of COX10 modification.

Addressing these challenges requires interdisciplinary approaches combining membrane protein biochemistry, advanced structural biology techniques, and systems biology methodologies.

How might COX10 function relate to the unique lipid metabolism capabilities of Y. lipolytica?

The relationship between COX10 function and Y. lipolytica's distinctive lipid metabolism presents an intriguing area for investigation:

  • Energy-lipid metabolism nexus: As a key component of the respiratory chain, COX10 influences ATP production and the redox balance of the cell. These factors directly impact lipid biosynthesis pathways, which require both energy and reducing equivalents. Y. lipolytica's ability to accumulate lipids up to 67.66% of its dry cell weight suggests highly efficient energy metabolism that could be further enhanced through COX10 optimization.

  • Mitochondrial-lipid droplet interaction: Research in other organisms has shown that mitochondria physically interact with lipid droplets. COX10's role in mitochondrial function may indirectly influence these interactions in Y. lipolytica, affecting lipid storage dynamics.

  • Metabolic flux redistribution: Alterations in respiratory efficiency due to COX10 modifications could redirect carbon flux between lipid accumulation and other metabolic pathways, potentially offering a novel approach to controlling lipid composition and quantity.

  • Stress response coordination: Both mitochondrial function and lipid metabolism are involved in cellular stress responses. COX10 may participate in coordinating these responses, particularly under nutrient limitation conditions that trigger lipid accumulation in Y. lipolytica.

  • Beta-oxidation regulation: Y. lipolytica efficiently utilizes hydrophobic substrates through beta-oxidation, which is tightly coupled to mitochondrial respiration. COX10 functionality likely influences the efficiency of this process, affecting the cell's ability to grow on lipid substrates.

Future research should explore these connections through targeted COX10 modifications combined with lipidomic and metabolomic analyses to elucidate the precise relationships between heme metabolism, respiratory function, and lipid accumulation in Y. lipolytica.

What potential applications exist for engineered COX10 variants in synthetic biology using Y. lipolytica?

Engineered COX10 variants offer several promising applications in Y. lipolytica synthetic biology:

  • Metabolic switches: Modified COX10 variants could function as metabolic switches, allowing controlled shifting between respiratory and fermentative metabolism in response to specific signals. This could enable dynamic regulation of product synthesis pathways in industrial processes.

  • Enhanced terpenoid production: Given Y. lipolytica's demonstrated capacity for β-carotene production and COX10's indirect influence on terpenoid precursor availability, engineered COX10 variants could enhance the production of commercially valuable terpenoids .

  • Oxygen-responsive biosensors: COX10's role in the respiratory chain makes it sensitive to oxygen availability. Engineered COX10-based biosensors could monitor oxygen levels in bioreactors, triggering appropriate responses in engineered strains.

  • Mitochondrial engineering platform: COX10 modifications could serve as part of a broader mitochondrial engineering platform, allowing researchers to modify mitochondrial function for various biotechnological applications.

  • Stress-resistant industrial strains: By optimizing COX10 functionality, researchers could develop Y. lipolytica strains with enhanced tolerance to industrial stresses, improving their performance in bioproduction processes.

Implementing these applications would benefit from the advanced genetic engineering tools now available for Y. lipolytica, including the Cre/lox-based genetic tool that enables repeated, targeted, and markerless gene integration .

How do alterations in COX10 expression or activity affect genome-wide expression patterns in Y. lipolytica?

Alterations in COX10 expression or activity likely trigger complex regulatory responses affecting genome-wide expression patterns in Y. lipolytica:

  • Retrograde signaling pathways: Disruption of mitochondrial function through COX10 modification likely activates retrograde signaling pathways from mitochondria to the nucleus, altering the expression of numerous nuclear genes involved in metabolism, stress response, and biosynthetic processes.

  • Energy metabolism reprogramming: Changes in respiratory efficiency due to COX10 alterations would necessitate compensatory changes in expression of genes involved in glycolysis, TCA cycle, pentose phosphate pathway, and lipid metabolism to maintain energy homeostasis.

  • Redox balance adjustments: As respiratory function affects cellular redox balance, COX10 modifications would likely alter expression of genes involved in maintaining NAD+/NADH ratios and managing oxidative stress.

  • Oxygen-responsive gene networks: In S. aureus, protoheme IX farnesyltransferase affects the expression of cytolytic toxins, suggesting its role in oxygen-responsive gene regulation . Similar oxygen-responsive networks might be influenced by COX10 in Y. lipolytica.

  • Lipid metabolism regulation: Given Y. lipolytica's oleaginous nature, COX10-mediated changes in cellular energetics would likely trigger significant adjustments in lipogenic and lipolytic gene expression.

To fully characterize these effects, researchers should employ RNA-seq analysis comparing wild-type and COX10-modified strains under various growth conditions, combined with metabolomic profiling to correlate transcriptional changes with metabolic outcomes. Particular attention should be paid to genes involved in lipid metabolism, given their significance in Y. lipolytica's biotechnological applications .

What are common technical issues when working with recombinant Y. lipolytica COX10 and how can they be addressed?

Researchers working with recombinant Y. lipolytica COX10 often encounter several technical challenges that require specific troubleshooting approaches:

IssueLikely CausesRecommended Solutions
Low expression yieldToxicity to host cells, poor codon optimization, formation of inclusion bodiesUse lower induction temperatures (16-20°C), optimize codon usage for expression host, use solubility tags, test different E. coli strains
Loss of activity during purificationDetergent-induced denaturation, cofactor loss, oxidation of critical residuesScreen multiple detergents, include stabilizing agents, maintain reducing conditions, add protease inhibitors
Protein aggregation after reconstitutionImproper buffer conditions, suboptimal protein-to-lipid ratio, insufficient removal of denaturing agentsOptimize buffer composition, screen different lipid formulations, use controlled dialysis for detergent removal
Poor reproducibility in activity assaysVariation in substrate quality, inconsistent reconstitution, enzyme instabilityStandardize substrate preparation, develop robust reconstitution protocols, include internal controls
Difficulty in achieving homogeneous protein preparationsMultiple conformational states, protein degradation, lipid heterogeneityUse size exclusion chromatography as final purification step, optimize storage conditions, ensure sample freshness

When troubleshooting these issues, researchers should systematically evaluate each step of the expression, purification, and reconstitution process, making incremental modifications and thoroughly documenting outcomes to identify optimal conditions for their specific experimental needs .

What strategies can be employed to study the structure-function relationship of Y. lipolytica COX10?

Elucidating the structure-function relationship of Y. lipolytica COX10 requires integrating multiple experimental approaches:

  • Homology modeling and molecular dynamics simulations: Using the known structures of related enzymes from other organisms to predict Y. lipolytica COX10 structure, followed by simulation of substrate binding and catalytic activity.

  • Site-directed mutagenesis: Systematic modification of predicted catalytic residues, transmembrane domains, and substrate binding sites to correlate specific amino acids with enzyme function. This can be accomplished using the enhanced homologous recombination approaches demonstrated in Y. lipolytica .

  • Chimeric protein analysis: Creating fusion proteins between Y. lipolytica COX10 and homologs from other organisms to identify domains responsible for species-specific functional differences.

  • Cryo-electron microscopy: For structural determination of the membrane-bound protein, potentially in complex with other respiratory chain components.

  • Hydrogen-deuterium exchange mass spectrometry: To probe conformational dynamics and identify regions critical for substrate binding and catalysis.

  • Crosslinking studies: To identify interaction partners and conformational changes during the catalytic cycle.

  • In vivo complementation assays: Testing the ability of mutant COX10 variants to restore respiratory function in COX10-deficient strains, correlating structural features with physiological outcomes.

When applying these strategies, researchers should consider the challenges of working with membrane proteins and the potential for structure-function relationships to be influenced by the lipid environment, which may differ between Y. lipolytica and model organisms.

How can researchers effectively integrate COX10 manipulation with other genetic modifications in Y. lipolytica metabolic engineering?

Successful integration of COX10 manipulation with other genetic modifications requires strategic planning and technical considerations:

  • Sequential modification approach: Utilize the Cre/lox-based genetic tool that enables repeated, targeted, and markerless gene integration in Y. lipolytica . This system allows for multiple rounds of genetic modification using a single selection marker, making it ideal for complex engineering projects involving COX10 and other targets.

  • Pathway compatibility analysis: Before implementation, conduct in silico modeling to predict how COX10 modifications will interact with other planned genetic changes, particularly those affecting central carbon metabolism or redox balance.

  • Modular cloning strategies: Employ modular cloning systems (e.g., Golden Gate assembly) to facilitate rapid construction and testing of multiple gene combinations involving COX10 and other pathway components.

  • Inducible expression systems: Implement orthogonal inducible expression systems for different genetic modifications, allowing temporal control over COX10 expression relative to other engineered pathways.

  • High-throughput phenotyping: Develop screening methods to rapidly assess the combined effects of COX10 modifications and other genetic changes on relevant phenotypes (growth rate, product formation, stress tolerance).

  • Multi-omics analysis: Apply transcriptomic, proteomic, and metabolomic approaches to comprehensively characterize strains with multiple modifications, identifying unexpected interactions between COX10 alterations and other engineered features.

  • Adaptive laboratory evolution: Follow rational engineering with adaptive evolution to optimize the performance of complex engineered strains, potentially revealing compensatory mutations that enhance the compatibility of different modifications.

By applying these strategies, researchers can effectively combine COX10 engineering with other metabolic modifications to develop Y. lipolytica strains with superior properties for biotechnological applications, such as the enhanced lipid utilization and β-carotene production demonstrated in previous studies .

What analytical methods are most appropriate for assessing the impact of COX10 modifications on Y. lipolytica metabolism?

Comprehensive assessment of COX10 modifications' impact on Y. lipolytica metabolism requires a multi-faceted analytical approach:

  • Respirometry analysis:

    • High-resolution respirometry to quantify oxygen consumption rates

    • Measurement of respiratory control ratios to assess coupling efficiency

    • Inhibitor titrations to evaluate specific respiratory chain complexes

  • Metabolic flux analysis:

    • ¹³C-metabolic flux analysis to trace carbon flow through central metabolic pathways

    • Metabolic flux ratio analysis to determine relative contributions of parallel pathways

    • Extracellular flux analysis for real-time measurement of cellular respiration

  • Lipidomics:

    • Comprehensive lipid profiling using LC-MS/MS to quantify changes in lipid species

    • Analysis of lipid droplet formation and composition

    • Phospholipid profiling to assess membrane composition changes

  • Heme analysis:

    • HPLC-based quantification of different heme species

    • Absorption spectroscopy to assess cytochrome content and status

    • Mass spectrometry for detailed heme modification analysis

  • Energy metabolism parameters:

    • ATP/ADP ratio measurements

    • NAD⁺/NADH and NADP⁺/NADPH ratio determinations

    • Membrane potential assessments using fluorescent probes

  • Growth phenotyping:

    • Growth kinetics under various carbon sources

    • Nutrient limitation response profiling

    • Stress tolerance characterization

  • Transcriptomics and proteomics:

    • RNA-seq analysis to identify gene expression changes

    • Targeted proteomics of respiratory complexes and metabolic enzymes

    • Post-translational modification analysis of key proteins

When applying these methods, researchers should design experiments that compare COX10-modified strains with appropriate controls under standardized conditions, and consider how modifications might affect metabolism differently under various growth phases and nutrient availabilities.

What are the most promising future research directions for understanding and utilizing Y. lipolytica COX10 in biotechnology?

Several high-potential research directions emerge for Y. lipolytica COX10 in biotechnology:

  • Precision engineering of respiratory efficiency: Developing COX10 variants with enhanced activity or altered regulation could enable fine-tuning of respiratory metabolism, potentially improving yields of target compounds that require balanced redox conditions or specific energy input levels.

  • Integration with genome-scale metabolic engineering: Incorporating COX10 modifications into genome-scale metabolic engineering strategies for Y. lipolytica could create industrial strains with optimized energy metabolism tailored for specific bioprocesses.

  • Stress response engineering: Exploring the relationship between COX10 function and cellular stress responses could lead to more robust industrial strains capable of maintaining productivity under suboptimal conditions.

  • Synthetic regulatory networks: Developing synthetic regulatory systems that modulate COX10 expression in response to specific process parameters could enable dynamic control of cellular metabolism during industrial fermentations.

  • Comparative studies across yeast species: Systematic comparison of COX10 function across diverse yeast species could reveal evolutionary adaptations that could be transferred to Y. lipolytica to enhance its industrial capabilities.

  • Novel product synthesis pathways: Leveraging the connection between respiratory function and terpenoid biosynthesis to develop new production pathways for high-value compounds, building on the demonstrated success in β-carotene production .

  • Mitochondrial engineering platform: Developing COX10 modifications as part of a broader mitochondrial engineering platform could enable comprehensive optimization of organelle function for industrial applications.

These directions align with the demonstrated potential of Y. lipolytica as an industrial host, particularly its natural propensity for lipid accumulation and the proven success of genetic engineering approaches in enhancing its performance .

How does current knowledge of COX10 in Y. lipolytica compare with other well-studied biological systems?

Comparative analysis reveals both knowledge gaps and unique features of COX10 in Y. lipolytica:

AspectY. lipolytica COX10S. cerevisiae COX10Mammalian COX10
Structural characterizationLimited, primarily sequence-based Moderately characterizedWell-characterized with disease-associated mutations identified
RegulationPoorly understoodKnown to respond to oxygen levelsWell-studied, linked to mitochondrial diseases
Metabolic contextStudied in the context of lipid metabolism and growth Understood in respiratory vs. fermentative metabolismExtensively studied in relation to mitochondrial diseases
Interaction partnersLimited informationSeveral known interactionsWell-characterized interactions with other proteins
Genetic tools for manipulationAdvanced tools available Extensive genetic toolkitVarious model systems available
Connection to product formationDemonstrated for β-carotene production Limited informationNot directly applicable

While knowledge of Y. lipolytica COX10 lags behind well-studied systems in some respects, the unique metabolic context of this oleaginous yeast offers distinctive opportunities for biotechnological applications. The advanced genetic tools now available for Y. lipolytica provide researchers with powerful means to fill knowledge gaps and leverage COX10 for metabolic engineering purposes.

Studies in other organisms, such as the connection between protoheme IX farnesyltransferase and toxin production in S. aureus , suggest that heme biosynthesis enzymes may have broader regulatory roles than currently recognized in Y. lipolytica, presenting intriguing areas for future investigation.

What interdisciplinary approaches might accelerate progress in understanding and manipulating COX10 function in Y. lipolytica?

Accelerating progress in COX10 research requires integration of multiple scientific disciplines:

  • Synthetic biology and systems biology: Combining rational design principles with systems-level analysis to understand how COX10 modifications propagate through cellular networks and affect global physiology.

  • Computational biology and bioinformatics: Employing advanced modeling approaches to predict COX10 structure, function, and interactions, guiding experimental design and interpretation.

  • Evolutionary biology and comparative genomics: Analyzing COX10 across diverse species to identify conserved features and unique adaptations that could inform engineering strategies.

  • Chemical biology and enzyme engineering: Developing chemical probes and enzyme variants to dissect COX10 function and create modified versions with enhanced or novel activities.

  • Biophysics and structural biology: Applying cutting-edge techniques for membrane protein characterization to elucidate COX10 structure-function relationships.

  • Process engineering and bioproduction: Translating fundamental insights into practical applications through integrated bioprocess development and scale-up strategies.

  • Metabolic engineering and synthetic metabolism: Creating artificial metabolic pathways that leverage or complement COX10 function for novel bioproduction capabilities.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.