Recombinant Yarrowia lipolytica Squalene synthase (SQS1)

Shipped with Ice Packs
In Stock

Description

Function and Importance

Squalene synthase (SQS1) is essential for sterol production in Yarrowia lipolytica . Sterols, like cholesterol in animals and ergosterol in fungi, play vital roles in maintaining cell membrane structure and function . Squalene, the product of the SQS1 enzyme, is a precursor to various sterols and other isoprenoids .

Yarrowia lipolytica as a Host

Yarrowia lipolytica is an attractive host organism for producing various metabolites, including lipids, proteins, and organic acids . Several characteristics contribute to its usefulness:

  • It is considered a generally recognized as safe (GRAS) organism, which facilitates its use in industrial applications .

  • It has a naturally high acetyl-CoA flux, making it suitable for synthesizing terpenoids and other isoprenoids .

  • Genetic toolkits are available for engineering Y. lipolytica strains to enhance the production of specific compounds .

Production of Terpenoids

Metabolic engineering strategies, such as overexpressing ATP citrate lyase (ACL) and acetyl-CoA synthetase (SeACS), can increase squalene production in Y. lipolytica . Overexpression of HMG, which encodes 3-hydroxy-3-methylglutaryl-CoA reductase, can also boost the production of α-farnesene, linalool, and limonene in Y. lipolytica .

Applications of Recombinant SQS1

Recombinant Y. lipolytica SQS1 has potential applications in various fields:

  • Production of Terpenoids: Engineered Y. lipolytica strains can overproduce valuable terpenoids, which have applications in pharmaceuticals, cosmetics, and biofuels .

  • Enzyme Assays: Recombinant SQS1 can be used in enzyme assays to study its activity and inhibition .

  • Research: SQS1 is useful for research purposes, like in ELISA tests .

Challenges and Future Directions

Despite its potential, challenges remain in optimizing the production of recombinant SQS1 and its applications:

  • Genetic Instability: Genetically modified strains may exhibit genetic instability during long-term continuous fermentation, which can reduce product yield .

  • Metabolic Engineering: Further optimization of metabolic pathways is needed to maximize the production of desired compounds .

  • Protein Unfolding: Further research is necessary to confirm the hypothesis that lipid metabolism plays a crucial role in cellular physiology and proteostasis of Y. lipolytica .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
SQS1; YALI0A10076g; Squalene synthase; SQS; SS; FPP:FPP farnesyltransferase; Farnesyl-diphosphate farnesyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-445
Protein Length
full length protein
Species
Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica)
Target Names
SQS1
Target Protein Sequence
MGKLIELLLHPSELSAAIHYKLWRQPLHPRDLSKESTELRRCYELLDVCSRSFAAVIREL HPEVRDAVMLFYLILRALDTIEDDMTLSRDIKIPILRDFTKCMKTPGWKFTDSDPNERDR VVLQEFPVVMTEFNKLKPKYQEVIYDITDRMGNGMADYVIDDDFNNNGVDTIAAYDLYCH HVAGIVGEGLTRITILAGFGTDVLHENPRLQESMGLFLQKVNIIRDYREDIDVNRAFWPR EIWHKYAEEMRDFKDPKYSKKALHCTSDLVANALGHATDCLDYLDNVTDPSTFTFCAIPQ VMAIATLDLVYRNPDVFQKNVKLRKGTTVSLILEASNVSGVCDIFTRYARKVYKKSDPND PNYFRVSVLCGKIEQHAALIKRQRGPPAKTIAQLEGERKEMALSLIVCLAVIFSMSGLMA YIAYVSGFRWSPREIFDSKMFPLRD
Uniprot No.

Target Background

Function

Squalene synthase (SQS1) from Yarrowia lipolytica catalyzes the condensation of two farnesyl pyrophosphate molecules to form squalene. This enzyme initiates the committed step in sterol biosynthesis and is essential for ergosterol production.

Database Links
Protein Families
Phytoene/squalene synthase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

How is SQS1 engineered in Y. lipolytica to enhance squalene production?

SQS1 overexpression is achieved through multi-copy integration or promoter replacement. Native squalene synthase (SQS) is often downregulated in non-triterpenoid strains by replacing its promoter (e.g., pERG9) with weaker promoters like pERG11 to redirect flux toward desired terpenoids . For triterpenoid production, SQS is upregulated alongside squalene epoxidase (SQE) to increase 2,3-oxidosqualene .

Key strategies:

StrategyMechanismImpact on Squalene Yield
Promoter replacementpERG9 → pERG11 (weak promoter)Redirects flux from sterols
Multi-copy integrationrDNA/LTR targeting with ura3d4 markerIncreases SQS1 expression
Metabolic precursor tuningOverexpress ACL1/SeACS for acetyl-CoABoosts IPP/DMAPP pools

What upstream/downstream pathways compete with SQS1 for precursors?

SQS1 competes with sterol synthesis (via lanosterol synthase, ERG7) and lipid metabolism (e.g., fatty acid biosynthesis). Downregulating ERG7 (via promoter truncation) or blocking sterol pathways enhances squalene accumulation . Additionally, NADPH recycling from the mannitol cycle mitigates redox imbalance caused by high SQS1 activity .

How to optimize Y. lipolytica strains for high squalene yields?

Strain optimization involves:

  • Genetic engineering:

    • Overexpress HMG-CoA reductase (HMG1) to relieve MVA-pathway bottlenecks .

    • Delete po1 (pyruvate kinase) to redirect pyruvate toward acetyl-CoA .

  • Media optimization:

    • Adjust C/N ratio to favor lipid accumulation (e.g., 40 g/L glucose + 2.5 g/L NH₄Cl) .

    • Maintain pH 6.0–6.5 to minimize acetyl-CoA loss to lipids .

Performance comparison:

Engineering StrategySqualene Yield (mg/L)Fold Improvement vs Parental
HMG1 overexpression180.3 (glucose)~10×
Media optimization + HMG1502.7~29×

How to resolve discrepancies in SQS1 expression levels across studies?

Discrepancies arise from:

  • Promoter variability: Constitutive promoters (e.g., TEF) vs. inducible promoters (e.g., ICL1) .

  • Integration sites: rDNA vs. LTR zeta of Ylt1 affects copy number and stability .

  • Strain background: Oleaginous vs. non-oleaginous strains differ in lipid accumulation capacity .

Validation methods:

  • Quantitative PCR: Measure SQS1 mRNA levels across promoters.

  • Western blotting: Confirm protein expression (e.g., CYP11A1 detection in steroidogenic strains) .

  • Southern blotting: Verify multi-copy integration .

What methods are effective for heterologous SQS1 expression in non-Y. lipolytica hosts?

SQS1 has been expressed in S. cerevisiae to enhance fatty acid production. Key approaches include:

  • cDNA library screening: Identify SQS1 clones that suppress sterol synthesis, redirecting flux to free fatty acids .

  • Promoter compatibility: Use S. cerevisiae PGK1 promoter for constitutive expression .

Performance metrics:

Host StrainSQS1 Expression SystemOutcome
S. cerevisiae JV03pFL61-PGK1Increased free fatty acids
Y. lipolyticaMulti-copy p64PT/p67PTStabilized squalene production

How to apply CRISPR-Cas9 for SQS1 gene editing?

CRISPR-Cas9 enables precise promoter modifications (e.g., truncating ERG7) or gene deletions (e.g., po1) to redirect metabolic flux. Key steps:

  • Design guide RNAs: Target ERG7 or SQS promoter regions .

  • Deliver Cas9 and gRNA: Use plasmid or ribonucleoprotein (RNP) delivery .

  • Select edited strains: Screen via PCR or Southern blotting .

Case study: Truncating ERG7’s promoter to 50 bp reduced sterol synthesis by >80%, increasing squalene yields .

What metabolic flux analysis (MFA) tools are suitable for SQS1-engineered strains?

MFA integrates isotopic labeling (e.g., ¹³C-glucose) with metabolomics to quantify flux through MVA and shikimate pathways. Tools like:

  • Flux balance analysis (FBA): Predict optimal gene deletions to maximize squalene flux .

  • Isotopomer distribution analysis: Trace acetyl-CoA partitioning between SQS1 and lipogenesis .

Example application: MFA revealed that blocking pyruvate kinase (po1) increased acetyl-CoA availability for SQS1 by 40% .

How to integrate SQS1 with synthetic biology pathways?

Co-expression of SQS1 with:

  • Geranylgeranyl diphosphate synthase (GGPPS): Enables diterpene production while maintaining squalene synthesis .

  • Phosphoketolase: Diverts pyruvate to pentose phosphate pathway, reducing ethanol byproducts .

Synergy example: Overexpressing SQS1 and GGPPS variants (e.g., ERG20F88C) allows modular production of triterpenes and carotenoids .

What are the challenges in scaling SQS1-engineered strains to bioreactor levels?

Key challenges include:

  • Oxygen transfer limitations: Squalene synthesis requires high aeration to sustain MVA flux .

  • Acidic byproduct inhibition: Overaccumulation of organic acids (e.g., citrate) can inhibit growth .

  • Strain stability: Multi-copy integrations may lose plasmids during extended fermentation .

Solutions:

  • Fed-batch fermentation: Maintain glucose at 10–20 g/L to prevent overflow metabolism.

  • pH control: Buffer media to pH 6.0–6.5 using phosphate or citrate buffers .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.