Recombinant Yersinia enterocolitica Outer membrane virulence protein YopE (yopE)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Pathogenesis

YopE is a type III secretion system (T3SS) effector protein injected into host cells to subvert immune responses:

Key Mechanisms

  • GTPase-Activating Protein (GAP) Activity: Targets Rho GTPases (e.g., Rac1, RhoA), disrupting actin polymerization and preventing phagocytosis by macrophages and neutrophils .

  • Immunomodulation: Reduces reactive oxygen species (ROS) production in macrophages and inhibits caspase-1-dependent IL-1β maturation .

  • Regulation of Yop Translocation: Modulates the delivery of other Yop effectors (e.g., YopP, YopH) into host cells .

Cytotoxic Effects

  • Induces actin stress fiber collapse and membrane blebbing in infected cells .

  • Degraded via the ubiquitin-proteasome pathway in Y. enterocolitica O:8, fine-tuning its activity during infection .

YopE Stability and Virulence

YopE VariantPhenotypeOutcome in Infection
Wild-type YopE (O:8)Ubiquitinated at K62/K75; degraded by proteasomeFacilitates bacterial dissemination in mice
Mutant YopE (K62R/K75Q)Resists degradation; accumulates intracellularlyIncreased cytotoxicity but reduced liver/spleen colonization
YopE-deficient strainLacks cytoskeletal disruptionSeverely attenuated virulence

Synergistic Effects with Other Yops

  • YopE cooperates with YopH, YopT, and YopO to block phagocytosis by polymorphonuclear neutrophils (PMNs) .

  • YopE-mediated Rac1 inhibition suppresses IL-8 production and MAPK signaling in epithelial cells .

Applications in Research

Recombinant YopE is utilized to:

  1. Study bacterial immune evasion strategies .

  2. Investigate GTPase signaling pathways in host cells .

  3. Develop therapeutic inhibitors targeting type III secretion systems .

Product Specs

Buffer
**Delivery Form: Liquid** The default storage buffer for liquid delivery form is Tris/PBS-based buffer, containing 5%-50% glycerol.
**Note:** If you have a specific requirement for glycerol content, please specify it in your order notes.
**Delivery Form: Lyophilized Powder** The buffer used before lyophilization for lyophilized powder is Tris/PBS-based buffer containing 6% Trehalose.
Description

This product represents a recombinant Yersinia enterocolitica outer membrane virulence protein YopE (1-219aa) with an N-terminal 6xHis tag. The gene sequence encoding YopE is incorporated into a plasmid that includes a promoter, ribosome binding site (RBS), and terminator sequence for efficient expression. This plasmid is then linearized using restriction enzymes.

The recombinant YopE protein is produced using a cell-free expression system. This involves adding substrates, energy, amino acids, nucleotides, cofactors, salts, and an inducer IPTG to an E. coli cell-free extract. The inducer triggers the promoter, initiating transcription and translation of the yopE gene. The protein synthesis is monitored, and the reaction is harvested when the desired protein yield is achieved.

The harvested reaction mixture undergoes affinity chromatography to purify the YopE protein. The purified protein is then analyzed using SDS-PAGE to verify its identity and purity. The purity of the recombinant Yersinia enterocolitica YopE protein is over 90%.

Form
**Delivery Form:** Liquid or Lyophilized powder
**Note:** We will preferentially ship the format that we have in stock. However, if you have a specific requirement for the delivery form, please indicate it in your order notes. We will prepare the product according to your preference.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
It is recommended to briefly centrifuge this vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of this product depends on several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself. Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C, while the lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
N-terminal 6xHis-tagged
Synonyms
yopE; yop25; Outer membrane virulence protein YopE
Datasheet & Coa
Please contact us to get it.
Expression Region
1-219aa
Mol. Weight
26.9kDa
Protein Length
Full Length
Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Others
Source
in vitro E.coli expression system
Species
Yersinia enterocolitica
Target Names
yopE
Target Protein Sequence
MKISSFISTSLPLPASVSGSSSVGEMSGRSVSQQKSDQYANNLAGRTESPQGSSLASRIIERLSSMAHSVIGFIQRMFSEGSHKPVVTPALTPAQMPSPTSFSDSIKQLAAETLPKYMQQLSSLDAETLQKNHDQFATGSGPLRGSITQCQGLMQFCGGELQAEASAILNTPVCGIPFSQWGTVGGAASAYVASGVDLTQAANEIKGLGQQMQQLLSLM
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function

YopE is an essential virulence determinant and cytotoxic effector that plays a significant role in the resistance of Yersinia enterocolitica to phagocytosis.

Protein Families
YopE family
Subcellular Location
Cell outer membrane.

Q&A

What is YopE and what is its fundamental role in Yersinia enterocolitica virulence?

YopE is a critical virulence effector protein secreted by the Yersinia type III secretion system (T3SS). It functions primarily as a GTPase-activating protein (GAP) that targets small Rho GTPases, leading to inhibition of actin polymerization in host cells . This activity is crucial for:

  • Preventing phagocytosis by immune cells, particularly macrophages and neutrophils

  • Controlling pore formation in host cell membranes by modulating Rho GTPase activity

  • Disrupting the host cell cytoskeleton, causing cell rounding

  • Suppressing immune responses, allowing extracellular bacterial survival

YopE works synergistically with other Yersinia outer proteins (Yops) to evade the host immune system and establish infection. While YopE alone cannot confer full resistance to phagocytosis, it plays a critical role in the concerted virulence mechanism employed by Y. enterocolitica .

What are the structural domains of YopE and their specific functions?

YopE exhibits a modular architecture composed of distinct functional domains:

DomainPosition (amino acids)Function
Secretion signalN-terminal 15 residuesRequired for secretion via the T3SS injectisome
Translocation domainN-terminal 50 residuesRequired for translocation across host cell membranes
SycE chaperone binding domainResidues 15-50Interaction with SycE chaperone, necessary for secretion and translocation of full-length YopE
Inhibitory domainResidues 50-77Inhibits YopE release; this inhibition is overcome by SycE binding
Effector/catalytic domainC-terminal regionContains GAP activity targeting Rho GTPases; responsible for cytoskeletal disruption

This modular structure allows YopE to be efficiently secreted and translocated into target cells, where its effector domain can exert its pathogenic functions. Notably, the secretion and translocation signals are distinct from the chaperone-binding domain, revealing the complex regulation of YopE delivery into host cells .

How is YopE secreted and translocated into host cells?

YopE secretion and translocation follow a sophisticated multi-step process:

  • Initial expression: YopE is synthesized in the bacterial cytoplasm

  • Chaperone interaction: The chaperone SycE binds to residues 15-50 of YopE to maintain it in a secretion-competent state and prevent premature folding

  • Recognition by T3SS: The N-terminal 15 amino acids of YopE serve as a secretion signal recognized by the Ysc T3SS apparatus

  • Secretion through injectisome: YopE is secreted through the needle-like T3SS structure when bacteria contact host cells or under low calcium conditions

  • Translocation across host membrane: YopE crossing of the host cell membrane requires:

    • The N-terminal 50 amino acids of YopE

    • The translocator proteins YopB and YopD, which form a pore in the host cell membrane

    • Contact between bacteria and host cell β1-integrins, which triggers T3SS activation

  • Release of chaperone: Once inside the host cell, YopE dissociates from SycE and folds into its active conformation

Experimental detection of YopE translocation can be achieved using reporter systems such as YopE-β-lactamase or YopE-adenylate cyclase hybrids, which allow researchers to track the injection process both in vitro and in vivo .

What cell types are targeted by YopE during infection and how can this be experimentally determined?

YopE exhibits a distinct cellular tropism during infection, targeting multiple immune cell types as demonstrated through experimental approaches using reporter systems like YopE-β-lactamase fusions :

Cell TypeRelative TargetingExperimental Findings
B cellsHighest total numberParticularly CD19+CD21+CD23+ follicular B cells; display increased CD69 expression after YopE injection, indicating activation
NeutrophilsHighSignificant targets in both in vitro and in vivo studies
Dendritic cellsModerateImportant targets for YopE-mediated immunosuppression
MacrophagesModerateCritical for preventing phagocytosis and bacterial clearance
T cellsLowInteraction with T cells appears to be a relatively rare event

For experimental determination of YopE targeting:

  • YopE-β-lactamase reporter system: The most effective method for tracking Yop injection in vivo, allowing visualization of targeted cells by flow cytometry using fluorescent CCF4-AM substrate

  • Cell isolation and analysis: Following infection, different cell populations can be isolated from tissues (e.g., spleen) and analyzed for evidence of YopE injection

  • Immunofluorescence microscopy: Can detect YopE localization in specific cell types using antibodies against YopE or tagged versions of YopE

  • YopE-adenylate cyclase fusion: Allows quantitative assessment of translocation through measurement of cAMP production in target cells

These approaches have revealed that while B cells receive the highest total number of injected YopE proteins, the targeting efficiency varies by cell type and is influenced by experimental conditions and genetic background of both bacteria and host .

How does YopE interfere with host cell cytoskeleton and phagocytosis?

YopE employs a sophisticated molecular mechanism to disrupt host cytoskeletal dynamics and inhibit phagocytosis:

  • RhoGTPase inactivation: YopE functions as a GTPase-activating protein (GAP) that targets small RhoGTPases including RhoA, Rac1, and Cdc42

    • Accelerates conversion of active GTP-bound forms to inactive GDP-bound forms

    • Disrupts GTPase-dependent signaling cascades essential for cytoskeletal organization

  • Actin cytoskeleton collapse: By inactivating RhoGTPases, YopE causes:

    • Inhibition of actin polymerization and F-actin assembly

    • Disassembly of stress fibers and focal adhesions

    • Cell rounding due to cytoskeletal collapse

  • Phagocytosis inhibition mechanisms:

    • Prevents actin cup formation required for phagocytic engulfment

    • Disrupts focal complex assembly at sites of bacterial attachment

    • Interferes with signaling pathways required for phagocytosis completion

  • Cooperative action with other Yops:

    • YopE acts synergistically with YopH, YopT, and YopO to maximize phagocytosis resistance

    • Each Yop targets different components of the phagocytic machinery

    • YopE's RhoA-GAP activity also regulates pore formation, limiting Yop injection in a feedback mechanism

Experimental approaches to study these mechanisms include:

  • Fluorescence microscopy to visualize actin rearrangements in infected cells

  • Phagocytosis assays comparing wild-type bacteria with YopE mutants

  • RhoGTPase activity assays (pull-down of active GTP-bound forms)

  • Expression of constitutively active RhoGTPase mutants to bypass YopE effects

These studies demonstrate that while YopE is crucial for phagocytosis resistance, it requires coordinated action with other Yop effectors for maximum effectiveness in evading host immune responses .

What is the role of the SycE chaperone in YopE secretion and function?

The SycE chaperone plays multiple crucial roles in YopE biology that extend beyond simple protein stabilization:

  • YopE binding and recognition:

    • Specifically binds to residues 15-50 of YopE (the chaperone binding domain)

    • Forms a stable complex with YopE in the bacterial cytoplasm prior to secretion

    • This interaction is essential for efficient secretion and translocation of full-length YopE

  • Secretion and translocation enhancement:

    • Maintains YopE in a partially unfolded, secretion-competent state

    • Overcomes an inhibitory effect of residues 50-77 of YopE that would otherwise prevent secretion

    • May help target YopE to the T3SS machinery, although not strictly as a "secretion pilot"

  • Hierarchical regulation:

    • The SycE-binding domain and SycE itself appear necessary for YopE delivery by wild-type Yersinia

    • May introduce hierarchy among effectors to be delivered, prioritizing certain Yops

    • This is evidenced by the fact that polymutant Yersinia strains lacking most Yop effectors can deliver YopE lacking the SycE-binding site, while wild-type strains cannot

  • Experimental evidence:

    • Deletion of the SycE-binding domain (residues 15-50) prevents secretion and translocation of full-length YopE by wild-type bacteria

    • Removal of the inhibitory domain (residues 50-77) allows secretion even in the absence of SycE

    • Mutants lacking the N-terminal secretion signal (residues 1-15) but containing the SycE-binding domain are still not secreted, indicating SycE cannot compensate for the absence of the secretion signal

SycE thus serves as more than just a stabilizing chaperone—it plays active roles in regulating YopE secretion dynamics, possibly coordinating the hierarchical injection of different effectors during infection to maximize virulence potential .

How do different serotypes of Y. enterocolitica affect YopE stability and function?

Y. enterocolitica serotypes exhibit significant differences in YopE protein structure, stability, and function that impact bacterial virulence:

  • Serotype-specific YopE ubiquitination and degradation:

    • YopE from highly pathogenic serotype O8 is susceptible to ubiquitination and proteasomal degradation

    • YopE from serotypes O3 and O9 evades this degradation pathway

    • This differential susceptibility is due to two unique N-terminal lysines (K62 and K75) present only in serotype O8 YopE

  • Molecular determinants of degradation:

    • Experimental insertion of either K62 or K75 into serotype O9 YopE enables its ubiquitination and destabilization

    • These lysine residues serve as polyubiquitin acceptor sites

    • Despite high homology between serotype variants, these specific residues dictate protein fate in host cells

  • Functional consequences:

    • Accumulation of O3 and O9 YopE (due to evasion of degradation) is associated with enhanced cytotoxic effects

    • This represents a molecular adaptation that may influence pathogenesis

    • Creates a serotype-dependent difference in YopE stability and activity that could affect virulence

  • Experimental approaches:

    • Analysis of YopE protein levels in proteasome inhibitor-treated versus untreated cells

    • Western blotting to detect polyubiquitination patterns

    • Site-directed mutagenesis to introduce or remove ubiquitination sites

    • Cytotoxicity assays to measure functional consequences of different YopE variants

These findings indicate that seemingly minor sequence variations in YopE between serotypes can have significant impacts on protein stability and function, potentially contributing to differences in virulence between Y. enterocolitica strains. This has important implications for experimental design when working with recombinant YopE, as results may vary depending on which serotype's YopE sequence is used .

How can researchers effectively detect and measure YopE translocation in experimental settings?

Several sophisticated reporter systems have been developed to detect and quantify YopE translocation into host cells, each with specific advantages for different experimental questions:

  • YopE-β-lactamase (YopE-Bla) hybrid system:

    • Most widely used for in vivo tracking of Yop injection

    • Principle: β-lactamase cleaves fluorescent CCF4-AM substrate, causing shift from green to blue fluorescence in cells receiving YopE

    • Advantages:

      • Allows flow cytometric analysis of specific cell populations

      • Can be used both in vitro and in vivo

      • Provides single-cell resolution of translocation events

    • Validation: Successfully used to show that β1-integrins and RhoGTPases RhoA and Rac1 are involved in Yop injection

  • YopE-adenylate cyclase (YopE-CyA) fusion approach:

    • Principle: Calmodulin-dependent adenylate cyclase activity produces cAMP only inside eukaryotic cells

    • Applications:

      • Quantitative assessment of translocation efficiency

      • Mapping of YopE domains required for translocation

      • Demonstrated that N-terminal 50 amino acids are sufficient for translocation

    • Limitations: Requires cell lysis and biochemical cAMP measurement

  • YopE-GFP fluorescent protein fusions:

    • Can visualize bacteria in infection models, but limited for detecting actual translocation events

    • More suitable for localization studies than quantifying translocation

  • Immunological detection methods:

    • Western blotting of fractionated host cells to detect translocated YopE

    • Immunofluorescence microscopy using anti-YopE antibodies

    • Limited sensitivity compared to enzymatic reporter systems

  • Experimental considerations:

    • Cell type matters: Different host cells show varying susceptibility to YopE injection

    • Growth conditions: Temperature and calcium concentration affect T3SS expression

    • Bacterial strain background: Wild-type vs. polymutant strains show different translocation patterns

    • Reporter fusion design: Minimal disruption of YopE domains is critical for authentic behavior

For quantitative translocation studies, researchers should consider:

  • Using complementary approaches (e.g., YopE-Bla for single-cell analysis with YopE-CyA for quantification)

  • Including appropriate controls (T3SS-deficient mutants, heat-killed bacteria)

  • Validating findings across multiple cell types and experimental conditions

  • Considering the impact of reporter fusions on YopE function and stability

These systems have provided crucial insights into the cellular targets and molecular requirements for YopE translocation, significantly advancing our understanding of Y. enterocolitica pathogenesis .

How does YopE work synergistically with other Yop effectors to modulate host immune responses?

YopE functions as part of a sophisticated virulence strategy that involves coordinated action with other Yop effectors to comprehensively suppress host immune defenses:

Understanding this synergistic action is crucial for developing effective countermeasures against Yersinia infections and for potentially adapting Yop effectors as research tools for immunological studies .

What advanced experimental approaches can be used to study YopE-host protein interactions and signaling pathways?

Researchers investigating YopE-host interactions can employ several cutting-edge methodologies to elucidate molecular mechanisms and signaling dynamics:

  • Proximity-based interactome mapping:

    • BioID or TurboID: Fusion of biotin ligase to YopE to biotinylate proximal proteins

    • APEX2-based proximity labeling: Allows temporal control of interaction mapping

    • Advantages: Captures transient interactions, works in intact cells, identifies proximal proteins rather than just direct binding partners

  • Live-cell imaging and biosensors:

    • FRET-based RhoGTPase activity sensors to visualize YopE-mediated GTPase inactivation in real-time

    • Split fluorescent protein complementation to visualize YopE-target interactions

    • Optogenetic control of YopE expression or localization to dissect temporal aspects of function

  • Advanced proteomics approaches:

    • Quantitative phosphoproteomics to map YopE-induced signaling changes

    • Ubiquitylome analysis to study serotype-specific degradation mechanisms

    • SILAC or TMT labeling for precise quantification of proteome changes

    • Crosslinking mass spectrometry (XL-MS) to map interaction interfaces

  • Structural biology methods:

    • Cryo-EM to visualize YopE-host protein complexes

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map conformational changes

    • NMR studies of YopE-target protein interactions

  • Cell-based functional assays:

    • CRISPR/Cas9 screening to identify host factors required for YopE function

    • Reconstitution systems in yeast or mammalian cells to test specific interactions

    • Microfluidic single-cell analysis of YopE translocation and host cell responses

  • Advanced in vivo approaches:

    • Intravital microscopy with fluorescent YopE fusions to track injection in live animals

    • Cell-type specific expression of inhibitors or biosensors to dissect in vivo effects

    • Single-cell RNA-seq of infected tissues to map transcriptional consequences

  • Synthetic biology approaches:

    • Engineering chimeric YopE variants with domains from different serotypes

    • Creating YopE with artificial ubiquitination sites or degradation signals

    • Developing optogenetically controlled YopE to precisely modulate activity

When designing these experiments, researchers should consider:

  • The potential impact of tags, fusions, or mutations on YopE structure and function

  • The differences between YopE variants from different serotypes

  • The cooperative nature of Yop effectors and potential confounding effects in bacterial systems

  • Appropriate controls for T3SS-dependent translocation versus other delivery methods

These advanced approaches can provide unprecedented insights into the molecular mechanisms of YopE function and potentially inform therapeutic strategies targeting T3SS effectors or their host targets.

What are the latest developments in using recombinant YopE for immunological research and potential therapeutic applications?

Recent advances have expanded the potential applications of recombinant YopE beyond basic pathogenesis research into innovative immunological tools and therapeutic development:

  • YopE as an immunomodulatory research tool:

    • Recombinant YopE can be used to selectively target and modulate specific immune cell populations identified as primary targets (B cells, neutrophils, dendritic cells)

    • The modular structure of YopE allows creation of chimeric proteins with different functional domains for precise immunological research

    • YopE-based tools can help dissect RhoGTPase signaling pathways in different immune cell types

  • Development of cell-penetrating YopE variants:

    • Inspired by the discovery of cell-penetrating effector proteins (CPEs) like YopM

    • Engineering YopE to autonomously enter cells without requiring the T3SS machinery

    • Potential applications as self-delivering immunomodulatory proteins

  • Serotype-specific modifications for stability control:

    • Leveraging the differential ubiquitination between O8 and O3/O9 YopE variants

    • Engineering ubiquitination sites to control protein stability and activity duration

    • This allows creation of YopE variants with predictable half-lives for research applications

  • Therapeutic applications exploration:

    • YopE as a potential bacteria-derived biologic for targeted immunomodulation

    • Development of natural or artificial cell-penetrating forms of YopE as anti-inflammatory therapeutics

    • YopE-derived peptides that maintain GAP activity but with reduced immunogenicity

  • Vaccine development and diagnostic applications:

    • Recombinant YopE as a component in subunit vaccines against Yersinia

    • YopE-specific antibody detection for diagnostic purposes

    • Modified YopE as an adjuvant or delivery system for other antigenic components

  • Methodological advances in recombinant production:

    • Optimized expression systems for different YopE variants

    • Enhanced purification protocols that maintain native structure and function

    • Development of stabilized YopE variants for improved handling and storage

  • Challenges and considerations:

    • Potential immunogenicity of bacterial proteins in therapeutic applications

    • Specificity concerns when targeting ubiquitous signaling pathways like RhoGTPases

    • Delivery methods for cell-specific targeting in complex tissues

These developments represent a shift from viewing YopE solely as a virulence factor to recognizing its potential as a precision tool for immunological research and therapeutic development . Researchers should carefully consider the specific YopE variant, delivery method, and target cell population when designing studies utilizing recombinant YopE.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.