Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Arginine exporter protein ArgO (argO)

Shipped with Ice Packs
In Stock

Description

Functional Role and Pathogenicity

ArgO is hypothesized to play a role in arginine export, potentially contributing to:

  • Nutrient acquisition: Export of arginine may modulate metabolic pathways in Y. enterocolitica.

  • Host adaptation: While direct evidence is limited, arginine metabolism is linked to bacterial survival in acidic environments (e.g., gut niches) .

Current research focuses on structural analogs and functional interactions. For instance, comparative transcriptomic studies of Y. enterocolitica O:8 and O:3 strains highlight differences in virulence factor expression, though ArgO-specific regulation remains unexplored .

Applications in Research and Biotechnology

ArgO serves as a tool in diverse experimental contexts:

ApplicationDetailsSource
ELISA DevelopmentUsed as a target antigen for immunoassays detecting anti-Y. enterocolitica antibodies
Vaccine DevelopmentInvestigated as a subunit vaccine candidate due to surface localization
Structural StudiesRecombinant ArgO enables X-ray crystallography or NMR-based conformational analysis

Research Gaps and Future Directions

While ArgO’s structural properties are well-characterized, its precise physiological role and regulatory mechanisms remain understudied:

  • Regulatory Networks: No direct evidence links ArgO expression to OmpR, a key regulator of urease and other virulence factors in Y. enterocolitica .

  • Host-Pathogen Interactions: Potential interactions with host proteins (e.g., porins like OmpF/C) merit investigation, as seen in Y. enterocolitica-associated autoimmune conditions .

Comparative Analysis of Y. enterocolitica Serotypes

Genomic and transcriptomic studies reveal distinct pathoadaptation strategies between serotypes:

SerotypeKey FeaturesSource
O:8 (Biotype 1B)High pathogenicity; siderophore-dependent iron acquisition; strong systemic virulence
O:3Environmental adaptation; limited mouse virulence; distinct toxin expression (e.g., ystA)

ArgO’s expression profile across serotypes requires further investigation to clarify its role in niche-specific adaptation.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please specify this in your order; we will prioritize your request.
Synonyms
argO; YE3405; Arginine exporter protein ArgO
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-205
Protein Length
full length protein
Species
Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Target Names
argO
Target Protein Sequence
MLAVFLQGFALSAAMILPLGPQNAFVMNQGIKRQHHLMSASLCALSDIILICAGIFGGSA LLNRSPLLLALVTWGGVAFLLWYGWGALMAAWRGDSSSAAVAAGTQGRWRIIVTLLAVTW LNPHVYLDTFVVLGSLGGQLLPDVRPWFAFGAVSASVAWFFALALLAAWLSPWLNRPGSQ RVINLLVGGVMWFIAFQLARQGLNL
Uniprot No.

Target Background

Function
This protein is involved in arginine export and plays a critical role in regulating intracellular arginine levels and maintaining the appropriate balance between arginine and lysine.
Database Links

KEGG: yen:YE3405

STRING: 393305.YE3405

Protein Families
LysE/ArgO transporter (TC 2.A.75) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What distinguishes Yersinia enterocolitica serotype O:8 / biotype 1B from other serotypes in terms of virulence?

Y. enterocolitica strains are classified into different biotypes and serotypes (O:3, O:5,27, O:8, and O:9). Biotype 1B strains, particularly serotype O:8, demonstrate significantly higher virulence in mouse models compared to biotype 2-5 strains. This heightened pathogenicity has made 1B/O:8 strains the predominant model for studying Y. enterocolitica virulence factors and their mechanisms . While historically dominant in North America, the prevalence of this serotype has changed over time, with bioserotype 4/O:3 becoming increasingly common worldwide . The heightened virulence of 1B/O:8 strains likely stems from their unique combination of virulence factors, including those potentially regulated by or interacting with membrane transport systems like ArgO.

What is the predicted functional significance of the ArgO protein in bacterial physiology?

ArgO, as an arginine exporter protein, likely plays a critical role in amino acid homeostasis within Y. enterocolitica. While not specifically addressed in the provided search results, membrane transporters in pathogenic bacteria frequently contribute to:

  • Maintaining cytoplasmic arginine concentrations at optimal levels

  • Supporting protein synthesis during rapid growth phases

  • Contributing to acid stress responses (arginine-dependent acid resistance)

  • Potentially participating in virulence factor regulation

The importance of membrane proteins in Y. enterocolitica pathogenesis is supported by multiple studies examining various transporters and secretion systems, suggesting ArgO may have both metabolic and virulence-related functions.

What expression systems are most suitable for recombinant production of Y. enterocolitica membrane proteins?

For recombinant expression of Y. enterocolitica membrane proteins like ArgO, researchers should consider:

Expression SystemAdvantagesLimitationsRecommended Protocol Elements
E. coli BL21(DE3)Most common, simple inductionMay form inclusion bodiesLow temperature induction (16-20°C), Membrane-optimized vectors
E. coli C41/C43Designed for membrane proteinsLower yields than standard systemsIPTG concentration titration essential
Y. enterocolitica nativeNatural folding environmentMore complex genetic manipulationTemperature-based regulation (21°C vs 37°C)
Cell-free systemsAvoids toxicity issuesMore expensive, technically demandingSupplementation with lipids/detergents

When working with Y. enterocolitica proteins, it's particularly important to consider temperature-dependent expression, as the bacterium significantly modifies its membrane composition between 21°C and 37°C . For recombinant membrane proteins, addition of specific detergents during purification is essential to maintain protein stability and function.

How can I generate knockout or modified strains of Y. enterocolitica for studying ArgO function?

Creating genetic modifications in Y. enterocolitica can be accomplished using methods similar to those employed for other membrane protein studies in this organism. Based on documented approaches for creating Y. enterocolitica mutants , the following protocol framework is recommended:

  • Plasmid Construction: Create a suicide plasmid containing flanking regions of the argO gene cloned into a vector like pDS132, which carries chloramphenicol resistance and a sacB gene for counter-selection .

  • Transformation Process:

    • Transform the construct into E. coli DH5α initially

    • Transfer to helper strain (E. coli S17 λpir) for conjugation

    • Introduce into Y. enterocolitica via conjugation

    • Select transconjugants using chloramphenicol (34 μg/ml) on Yersinia selective medium

  • Mutant Selection:

    • Culture bacteria without antibiotics overnight

    • Transfer to media containing 10% sucrose without NaCl

    • Confirm mutants via antibiotic resistance profiles, PCR, and sequencing

For complementation studies, the wild-type argO gene can be reintroduced on a separate plasmid to verify that observed phenotypes are specifically due to argO disruption.

What methodologies are most effective for measuring arginine transport in Y. enterocolitica?

To effectively measure arginine transport mediated by ArgO in Y. enterocolitica, consider these methodological approaches:

  • Radiolabeled Substrate Transport Assays:

    • Use 14C or 3H-labeled arginine to track efflux rates

    • Compare wild-type strains to argO mutants under various environmental conditions

    • Investigate competitive inhibition using arginine analogs

  • Fluorescence-Based Transport Assays:

    • Employ arginine analogs with fluorescent properties

    • Use fluorescence microscopy or plate reader analysis to track transport kinetics

  • Growth Assays under Arginine Stress Conditions:

    • Compare growth rates of wild-type and argO mutants in media with varying arginine concentrations

    • Test growth under different pH conditions to evaluate arginine-dependent acid resistance

  • Membrane Vesicle Studies:

    • Prepare inside-out membrane vesicles from Y. enterocolitica

    • Measure ATP-dependent or ion gradient-dependent arginine transport

These methods should be performed at both 21°C and 37°C, given Y. enterocolitica's temperature-dependent expression patterns .

How might ArgO interact with known virulence mechanisms in Y. enterocolitica serotype O:8 / biotype 1B?

Y. enterocolitica virulence involves complex regulatory networks that may intersect with arginine metabolism and transport. While specific ArgO interactions aren't detailed in the search results, potential connections can be hypothesized based on known virulence mechanisms:

  • Interaction with the flagellar regulon: Y. enterocolitica is motile at 21°C but not at 37°C, with motility controlled by the flagellum master regulatory operon flhDC . Membrane proteins and transporters can influence flagellar expression through metabolic or signaling effects. ArgO may indirectly affect flhDC expression through arginine-dependent regulatory pathways.

  • Potential influence on Yop delivery: The Type III Secretion System (T3SS) delivers Yersinia outer proteins (Yops) directly into host cells to suppress immune responses . Amino acid transporters often function in concert with secretion systems, potentially providing necessary metabolic support. Given that YopM has been identified as a cell-penetrating effector protein , the cellular arginine environment controlled by ArgO could influence Yop efficacy.

  • Connection to temperature-dependent virulence: Y. enterocolitica significantly modifies its membrane and surface structures between environmental (21°C) and host (37°C) temperatures . ArgO activity and expression likely follow similar temperature-dependent patterns, potentially contributing to host adaptation.

Experimental designs to investigate these interactions should include comparative transcriptomics of wild-type and argO mutants under various environmental conditions, protein-protein interaction studies, and virulence assays in cellular and animal models.

What approaches can be used to study ArgO's structure-function relationship?

Understanding the structure-function relationship of ArgO requires multiple complementary approaches:

  • Computational Structural Prediction:

    • Homology modeling based on known bacterial amino acid transporters

    • Molecular dynamics simulations to predict transmembrane domains and substrate binding sites

    • Machine learning approaches to predict functionally important residues

  • Site-Directed Mutagenesis Strategy:

    • Target conserved residues in predicted transmembrane domains

    • Modify putative substrate binding sites

    • Create chimeric proteins with other bacterial transporters

  • Functional Characterization of Mutants:

    • Transport assays with wild-type and mutated versions

    • In vivo complementation tests

    • Protein stability and localization studies

The site-directed mutagenesis approach can be particularly informative, as demonstrated in studies of other Y. enterocolitica proteins like LpxR, where mutations (e.g., LpxR(N9A) and LpxR(S34A)) provided insights into catalytic function .

How does ArgO expression correlate with antibiotic resistance in Y. enterocolitica?

While not directly addressed in the search results for ArgO specifically, Y. enterocolitica isolates demonstrate varying patterns of antibiotic resistance that could potentially relate to membrane transporter expression:

AntibioticResistance Frequency in Animal IsolatesPotential Relation to Membrane Transporters
Ampicillin100% Membrane transporters may affect permeability or efflux
Cefotaxime100% Reduced penetration through modified membranes
Streptomycin83.3% Potential efflux through amino acid transporters
Chloramphenicol66.66% Membrane composition affects drug penetration
Gentamicin66.66% Amino acid transporters may contribute to adaptive resistance
NorfloxacinLow (highest sensitivity) Fluoroquinolones may bypass specific transporters

To investigate ArgO's potential role in antibiotic resistance:

  • Compare MIC (Minimum Inhibitory Concentration) values between wild-type and argO mutant strains

  • Examine ArgO expression levels in strains with different antibiotic resistance profiles

  • Test whether arginine supplementation affects antibiotic susceptibility

  • Investigate whether ArgO overexpression alters resistance patterns

What are the most common challenges in purifying recombinant ArgO protein and how can they be addressed?

Membrane protein purification presents several challenges, particularly for transporters like ArgO. Based on approaches used for other Y. enterocolitica proteins, researchers should consider:

  • Solubilization Challenges:

    • Problem: Insufficient extraction from membranes

    • Solution: Screen multiple detergents (DDM, LDAO, LMNG) at varying concentrations; consider using lipid nanodiscs for native-like environment

  • Protein Stability Issues:

    • Problem: Rapid degradation during purification

    • Solution: Include protease inhibitors; maintain consistent low temperature (4°C); add stabilizing agents like glycerol (10-20%)

  • Low Expression Yields:

    • Problem: Poor expression in recombinant systems

    • Solution: Optimize codon usage; use specialized expression strains; test induction at lower temperatures (16°C)

  • Confirmation of Functionality:

    • Problem: Purified protein lacks transport activity

    • Solution: Develop liposome reconstitution assays; compare activity in different detergent/lipid compositions

For verification of proper membrane localization in Y. enterocolitica, techniques similar to those used for LpxR studies can be adapted, including Western blot analysis of purified membrane fractions using FLAG-tagged constructs .

How can I resolve contradictory results in ArgO functional studies across different experimental models?

Researchers frequently encounter contradictory results when studying bacterial membrane transporters. To systematically address such discrepancies:

  • Standardize Experimental Conditions:

    • Maintain consistent growth phases for bacterial cultures

    • Control temperature precisely (particularly important for Y. enterocolitica, which exhibits different phenotypes at 21°C vs. 37°C)

    • Standardize media composition, especially amino acid content

  • Consider Strain Variations:

    • Different Y. enterocolitica isolates show significant phenotypic variations

    • Verify genetic background through whole-genome sequencing

    • Create isogenic strains for comparative studies

  • Employ Multiple Methodological Approaches:

    • Combine in vitro transport assays with in vivo functional studies

    • Use both genetic (knockouts/complementation) and biochemical approaches

    • Validate key findings in different model systems

  • Account for Host-Specific Differences:

    • Y. enterocolitica interactions vary between host species (e.g., mice vs. pigs)

    • Different immune responses may affect transporter function indirectly

    • Consider using host cells relevant to natural infection sites

When comparing results from different studies, remember that Y. enterocolitica strains can elicit host-specific immune responses, with serotype O:3 strains inducing lower IL-8 response in porcine macrophages compared to O:8 strains .

What emerging technologies might enhance our understanding of ArgO's role in Y. enterocolitica pathogenesis?

Several cutting-edge technologies show promise for advancing ArgO research:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Enables high-resolution structural analysis of membrane proteins in near-native environments

    • Can reveal conformational changes during transport cycles

    • May identify interaction sites with other virulence-associated proteins

  • CRISPR-Cas9 Genome Editing in Y. enterocolitica:

    • Allows precise genomic modifications with reduced off-target effects

    • Enables creation of conditional knockdown systems for essential transporters

    • Facilitates high-throughput mutagenesis studies

  • Single-Cell Techniques:

    • RNA-Seq at single-cell resolution to identify population heterogeneity in ArgO expression

    • Microfluidics-based assays to study ArgO activity in individual bacteria during infection

    • Live-cell imaging with fluorescent sensors to track arginine flux in real-time

  • Multi-Omics Integration:

    • Combining transcriptomics, proteomics, and metabolomics data

    • Network analysis to position ArgO within virulence-associated pathways

    • Machine learning approaches to predict conditions where ArgO activity is critical

These technologies could help resolve how ArgO contributes to the distinctive pathogenicity of Y. enterocolitica serotype O:8 / biotype 1B compared to other serotypes that show different host specificities and virulence patterns .

How might comparative studies between different Yersinia species inform our understanding of ArgO evolution and function?

Comparative analysis across Yersinia species can provide valuable insights into ArgO function:

  • Evolutionary Analysis Framework:

    • Compare argO sequences across pathogenic and non-pathogenic Yersinia species

    • Identify conserved domains versus variable regions that may relate to host specificity

    • Perform selection pressure analysis to identify positively selected residues

  • Functional Comparison Approach:

    • Create heterologous expression systems to test ArgO proteins from different Yersinia species

    • Compare transport kinetics, substrate specificity, and regulation

    • Determine if ArgO functional differences correlate with pathogenicity differences

  • Host-Interaction Studies:

    • Examine whether ArgO variants differ in their effects on host cell responses

    • Test if ArgO from highly virulent strains (like Y. enterocolitica 1B/O:8) confers enhanced survival in immune cells

    • Investigate potential co-evolution with host arginine metabolism pathways

This comparative approach is particularly valuable given the known differences in virulence and host specificity between Y. enterocolitica strains, where serotype O:3 and O:8 strains elicit different immune responses in porcine versus murine hosts .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.