Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Bifunctional protein aas (aas)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If a particular tag is required, please inform us, and we will prioritize its development.
Synonyms
aas; YE3327; Bifunctional protein Aas [Includes: 2-acylglycerophosphoethanolamine acyltransferase; 2-acyl-GPE acyltransferase; Acyl-[acyl-carrier-protein]--phospholipid O-acyltransferase; Acyl-[acyl-carrier-protein] synthetase; Acyl-ACP synthetase; Long-chain-fatty-acid--[acyl-carrier-protein] ligase]
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-718
Protein Length
full length protein
Species
Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Target Names
aas
Target Protein Sequence
MAYRLLRALFRGLFRVTIDGITDQFSHQKLIITPNHVSFLDGALLALFLPIKPVFAVYSN ITESWYMRWLKPYVDFVALDPTKPMAIKHLVRMVEQGRPVVIFPEGRITVTGSLMKIYDG AAFVAAKSGAAVVPIRLEGPEFTRFGRLGDVLKVRWFPKISIHVLPATTLPMPQAPRARD RRVLAGERLHAIMMAARMAIVPRETLFEALLSAQTRYGRFKPCIEDISFKEDSYQTLLKK ILGVSRILQRFTAQGEHVGMLLPNATITAAAIFGATLRGRIPALLNYTSGAKGLKSAITA ASLKTIITSRQFLEKGKLTHLPEQVTEANWVYLEDLKDTVTLADKLWILFHLCCPRRAMV PQQADDSALILFTSGSEGNPKGVVHSHASLLANVEQIRTIADFTPRDRFMSSLPLFHAFG LTVGLFTPLMTGSRVFLYPSPLHYRVVPELVYDRNCTVLFGTSTFLGNYARFAHPYDFAR LRYVVAGAEKLADSTKQIWQDKFGIRILEGYGVTECAPVVAINVPMAAKVNTVGRILPGM ESRVIPVPGIEQGGRLQLRGPNIMRGYLRVEKPGVLEQPSAENTQGEQEAGWYDTGDIVA IDEQGFCTIRGRMKRFAKLAGEMVSLESVEQLVLRISPEGQHAAATKTDSAKGEALVLFT TDSEITREKLVKAARESGVPELAVPRDIRVVKALPLLGSGKPDFVTLSKMAEDPEMSA
Uniprot No.

Target Background

Function

This bifunctional protein plays a crucial role in lysophospholipid acylation. It catalyzes the transfer of fatty acids to the 1-position of lysophospholipids via an enzyme-bound acyl-ACP intermediate, requiring ATP and magnesium. Its primary physiological function is the regeneration of phosphatidylethanolamine from 2-acyl-glycero-3-phosphoethanolamine (2-acyl-GPE), a byproduct of transacylation reactions or phospholipase A1 degradation.

Database Links

KEGG: yen:YE3327

STRING: 393305.YE3327

Protein Families
2-acyl-GPE acetyltransferase family; ATP-dependent AMP-binding enzyme family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Advanced Research Methodology

  • What are the optimal conditions for recombinant expression and purification of the Y. enterocolitica aas protein?

    For optimal recombinant expression of Y. enterocolitica aas protein, the following methodology is recommended:

    Expression System: E. coli-based expression systems have proven successful, with the full-length aas gene (1-718 aa) fused to an N-terminal His-tag in an appropriate expression vector .

    Culture Conditions: Induction protocols typically employ IPTG at mid-log phase (OD600 ~0.6), with expression at lower temperatures (16-25°C) for 16-18 hours to enhance protein solubility and proper folding.

    Purification Protocol:

    1. Harvest cells by centrifugation (5000×g, 15 min, 4°C)

    2. Lyse using buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, 1 mM PMSF, and lysozyme

    3. Purify using Ni-NTA affinity chromatography with an imidazole gradient

    4. Further purify by gel filtration chromatography if higher purity is required

    Storage Recommendations: Store in Tris/PBS-based buffer with 6% trehalose (pH 8.0) at -20°C/-80°C. To avoid repeated freeze-thaw cycles, prepare working aliquots with 5-50% glycerol for storage at -20°C .

  • How can researchers effectively analyze the enzymatic activity of recombinant aas protein?

    Researchers can analyze the enzymatic activity of recombinant aas protein through several complementary approaches:

    Acyltransferase Activity Assay:

    1. Prepare substrate mixture containing labeled glycerophosphoethanolamine and acyl-CoA donors

    2. Incubate with purified aas protein (1-5 μg) in buffer (50 mM Tris-HCl pH 7.5, 10 mM MgCl₂)

    3. Monitor product formation via thin-layer chromatography or HPLC

    4. Quantify using radioactive or fluorescent detection methods

    Membrane Fluidity Analysis:
    Measure the protein's effect on membrane fluidity using fluorescence polarization techniques with DPH probes, as described in research by Zaritsky et al. and applied to Y. enterocolitica . Calculate fluorescence anisotropy using the formula: A = [IVV − IVH(IHV/IHH)]/[IVV + 2IVH(IHV/IHH)], where decreases in anisotropy reflect increases in membrane fluidity .

    Thermal Shift Assays:
    Assess protein stability and substrate binding through differential scanning fluorimetry, monitoring the protein's unfolding in the presence or absence of substrates and cofactors.

  • What methodologies are recommended for investigating the role of aas in Y. enterocolitica pathogenesis?

    To investigate the role of aas in Y. enterocolitica pathogenesis, researchers should implement a multi-faceted approach:

    Gene Knockout and Complementation:

    1. Generate aas deletion mutants using allelic exchange techniques similar to those used for sif genes in Y. enterocolitica

    2. Complement with wild-type and site-directed mutant variants to identify critical residues

    3. Assess phenotypic changes in membrane composition and stress response

    In Vivo Expression Analysis:
    Apply IVET (in vivo expression technology) methodology to determine if aas is differentially expressed during infection, similar to approaches used to identify sif genes that are specifically expressed during systemic infection .

    Virulence Assessment:

    1. Analyze colonization abilities in mouse models using competitive index assays

    2. Evaluate survival in different host tissues and under immune system pressure

    3. Compare virulence between wild-type and aas mutant strains in BALB/c mice

    Membrane Integrity Studies:
    Investigate how aas affects membrane properties during host-pathogen interactions by measuring changes in membrane fluidity under conditions that mimic the host environment .

Experimental Design and Troubleshooting

  • What are the common challenges in studying the function of aas protein and how can they be overcome?

    Several challenges are commonly encountered when studying the aas protein:

    Protein Solubility Issues:

    • Challenge: The hydrophobic nature of membrane-associated proteins like aas often leads to inclusion body formation.

    • Solution: Optimize expression by using lower induction temperatures (16-20°C), solubility-enhancing fusion tags (SUMO or MBP), or membrane-mimetic environments during purification.

    Functional Redundancy:

    • Challenge: Multiple enzymes may have overlapping functions in phospholipid metabolism, masking phenotypes in knockout studies.

    • Solution: Generate multiple gene knockouts of related pathways or use specific inhibitors to block compensatory mechanisms. Apply metabolic labeling techniques to trace specific activities.

    In vitro vs. In vivo Activity:

    • Challenge: In vitro enzymatic assays may not reflect the protein's actual function in the complex cellular environment.

    • Solution: Develop cell-based assays that incorporate fluorescently labeled substrates or use liposome reconstitution systems to better mimic the native membrane environment.

    Stability During Storage:

    • Challenge: Purified protein may lose activity during storage.

    • Solution: Store in buffer containing 6% trehalose and 50% glycerol at -80°C, and avoid repeated freeze-thaw cycles by preparing smaller working aliquots .

  • How should researchers design experiments to investigate the relationship between aas function and Y. enterocolitica virulence in animal models?

    A comprehensive experimental design to investigate aas function in virulence should include:

    Animal Model Selection:

    • Use BALB/c mice as they have been validated for Y. enterocolitica infection studies

    • Consider both oral infection (to study gastrointestinal colonization) and intraperitoneal injection (for systemic infection)

    Experimental Groups:

    1. Wild-type Y. enterocolitica (positive control)

    2. aas deletion mutant

    3. Complemented aas mutant (genetic rescue)

    4. Site-directed mutants of critical residues in aas

    Measurement Parameters:

    • Bacterial burden in tissues (Peyer's patches, mesenteric lymph nodes, spleen, liver)

    • Histopathological assessment of tissue damage

    • Immune response markers (cytokines, immune cell recruitment)

    • Survival analysis

    Molecular Analysis:

    • In vivo gene expression analysis using techniques similar to those used to identify sif genes

    • Competitive index assays to measure fitness during co-infection

    • Membrane fluidity measurements from recovered bacteria

    Statistical Considerations:

    • Use power analysis to determine appropriate sample sizes

    • Apply appropriate statistical tests (ANOVA with post-hoc tests, survival analysis)

    • Include biological replicates and consider multiple timepoints post-infection

  • What advanced techniques are available for studying the protein-protein interactions of aas in its native membrane environment?

    Several advanced techniques can be employed to study aas protein-protein interactions:

    Proximity-dependent Biotin Identification (BioID):

    1. Generate aas-BirA* fusion constructs for expression in Y. enterocolitica

    2. Allow in vivo biotinylation of proximal proteins

    3. Purify biotinylated proteins and identify by mass spectrometry

    Cross-linking Mass Spectrometry (XL-MS):

    1. Use membrane-permeable cross-linkers on intact bacteria

    2. Isolate membrane fractions and perform cross-linked protein analysis

    3. Map interaction sites with amino acid resolution

    Förster Resonance Energy Transfer (FRET):
    Create fluorescently labeled aas constructs to monitor real-time interactions with potential partners in live cells or reconstituted membrane systems.

    Native Membrane Nanodisc Technology:

    1. Extract membrane proteins in native lipid environment

    2. Reconstitute into nanodiscs with defined composition

    3. Analyze protein interactions by size-exclusion chromatography or analytical ultracentrifugation

    Genetic Interaction Mapping:
    Perform systematic genetic crosses between aas mutants and other membrane protein mutants to identify functional relationships, similar to approaches used to characterize interactions between PspB and PspC in Y. enterocolitica .

Comparative Analysis and Research Applications

  • How does the function of aas compare to other membrane-associated virulence factors in Y. enterocolitica?

    The aas protein functions primarily in membrane lipid metabolism, which contrasts with other well-characterized Y. enterocolitica membrane-associated virulence factors:

    ProteinPrimary FunctionRole in VirulenceResearch Methods
    aasAcyltransferase activity, membrane fluidity regulationPotential role in stress adaptationEnzymatic assays, membrane fluidity measurements
    YadAAdhesin, serum resistanceBinds C4b-binding protein, prevents complement-mediated killingAffinity blotting, serum resistance assays
    AilAttachment-invasion locus proteinCell attachment, invasion, serum resistanceCell adhesion assays, PCR detection of ail gene
    PspB/PspCPhage-shock-protein responseEssential for virulence, secretin stress toleranceMutagenesis studies, β-galactosidase reporter assays

    Unlike YadA and Ail, which directly mediate host-pathogen interactions by binding host molecules, aas likely contributes to virulence indirectly by maintaining membrane integrity under stress conditions . While the Psp system responds to mislocalized outer membrane secretins and is essential for virulence, aas may function in parallel pathways of membrane homeostasis .

  • What bioinformatic approaches are most effective for analyzing the evolutionary relationships of aas across bacterial species?

    Effective bioinformatic approaches for evolutionary analysis of aas include:

    Sequence-Based Methods:

    1. Multiple Sequence Alignment (MSA) using MUSCLE or MAFFT algorithms to align aas sequences from diverse bacterial species

    2. Phylogenetic tree construction using Maximum Likelihood or Bayesian methods

    3. Calculation of selection pressure (dN/dS ratios) to identify conserved functional domains

    Structure-Based Analysis:

    1. Homology modeling based on crystal structures of related acyltransferases

    2. Structure-guided sequence alignment to identify functional conservation beyond sequence similarity

    3. Molecular dynamics simulations to compare protein dynamics across species

    Genomic Context Analysis:
    Examine the genomic neighborhood of aas genes across species to identify conserved operons or gene clusters, similar to the analysis of hreP gene organization in Y. enterocolitica compared to E. coli, Salmonella, and Y. pestis .

    Domain Architecture Analysis:
    Compare domain organization using tools like InterProScan to identify domain shuffling or fusion events in the evolutionary history of aas proteins.

    Network-Based Approaches:
    Construct protein-protein interaction networks or metabolic networks to understand the functional evolution of aas in different bacterial physiological contexts.

  • How can researchers integrate proteomic and transcriptomic approaches to understand the regulation of aas expression under different environmental conditions?

    An integrated multi-omics approach to understanding aas regulation should include:

    Experimental Design:

    1. Expose Y. enterocolitica to relevant environmental conditions (different temperatures, pH levels, nutrient availability, host cell contact)

    2. Collect samples for parallel RNA-seq and proteomic analysis

    3. Include appropriate timepoints to capture both immediate and adaptive responses

    Transcriptomic Analysis:

    1. RNA-seq to quantify aas mRNA levels under different conditions

    2. Identification of transcriptional start sites using 5'-RACE or Cappable-seq

    3. Analysis of co-expressed genes to identify potential operons or regulons

    Proteomic Analysis:

    1. Quantitative proteomics using TMT or SILAC labeling

    2. Post-translational modification analysis (phosphorylation, acetylation)

    3. Protein stability and turnover studies using pulse-chase experiments

    Integration Strategies:

    1. Correlation analysis between transcript and protein levels

    2. Pathway enrichment analysis to identify coordinated responses

    3. Network modeling to predict regulatory interactions

    This integrated approach can be modeled after studies of other Y. enterocolitica proteins, such as the work on sif genes where Western blot analysis was combined with transcriptional analysis to determine expression patterns under different growth conditions .

Future Research Directions

  • What emerging technologies might advance our understanding of the structure-function relationships of the aas protein?

    Several emerging technologies show promise for elucidating aas structure-function relationships:

    Cryo-Electron Microscopy:
    High-resolution structural determination of membrane proteins in near-native environments, potentially revealing how aas integrates into the bacterial membrane and interacts with substrate molecules.

    AlphaFold2 and Other AI-Based Structure Prediction:
    Leveraging machine learning approaches to predict accurate protein structures and protein-protein interactions, providing insights into functional domains and binding interfaces of aas.

    Single-Molecule Enzymology:
    Real-time observation of individual aas molecules during catalysis using fluorescence resonance energy transfer (FRET) or optical tweezers, revealing reaction intermediates and conformational changes.

    In-Cell NMR Spectroscopy:
    Structural and dynamic characterization of aas directly within living bacteria, capturing native conformational states and interactions.

    CRISPR-Based Precise Genome Editing:
    Generation of comprehensive libraries of aas variants with single amino acid substitutions to systematically map structure-function relationships in vivo.

    Microfluidics-Based Approaches:
    High-throughput screening of enzyme kinetics and membrane dynamics in controlled microenvironments that mimic physiological conditions.

  • How might the aas protein be utilized as a target for developing novel antimicrobial strategies against Yersinia enterocolitica?

    The aas protein presents several opportunities for antimicrobial development:

    Rational Drug Design Approaches:

    1. Structure-based design of competitive inhibitors that target the active site of aas

    2. Allosteric inhibitors that disrupt protein function by binding to regulatory sites

    3. Peptidomimetics that interfere with protein-protein interactions essential for aas function

    Membrane Disruption Strategy:
    Develop compounds that exploit alterations in membrane homeostasis when aas is inhibited, potentially creating synergistic effects with existing membrane-targeting antibiotics.

    Attenuated Vaccine Development:
    Engineer Y. enterocolitica strains with modified aas activity as potential live attenuated vaccine candidates, building on approaches used with other virulence factors like HreP .

    Combination Therapy Approaches:
    Target multiple membrane homeostasis pathways simultaneously, combining aas inhibitors with compounds affecting other membrane-associated processes like the Psp system .

    Biomarker Potential:
    Develop diagnostic assays that detect antibodies against aas or the protein itself as markers of Y. enterocolitica infection, complementing current detection methods that target ail and other virulence genes .

    Screening Methodology:
    Implement high-throughput screening methods using fluorescence-based assays that monitor changes in membrane fluidity when aas is inhibited .

  • What are the most significant unanswered questions regarding the role of aas in bacterial physiology and pathogenesis?

    Critical unanswered questions include:

    Regulatory Networks:
    How is aas expression regulated in response to environmental stressors, and which transcription factors directly control its expression? Studies similar to those analyzing PspBC regulation could provide insights .

    Host-Pathogen Interface:
    Does aas activity change during different stages of infection, and how do these changes affect virulence? Approaches similar to those used for identifying sif genes could help answer this question .

    Metabolic Integration:
    How does aas coordinate with other enzymes in phospholipid metabolism to maintain membrane homeostasis during infection? Metabolomic approaches could reveal these relationships.

    Structural Determinants:
    What are the precise structural features that determine substrate specificity and catalytic efficiency of aas? High-resolution structural studies are needed to address this.

    Evolutionary Adaptation:
    Why has the aas protein been conserved across different Yersinia species and related bacteria, and how has its function evolved to adapt to different ecological niches?

    Therapeutic Potential:
    Can selective inhibition of aas be achieved without affecting host enzymes with similar functions? This question is crucial for antimicrobial development.

    Environmental Sensing: Does aas function as part of a sensory mechanism that allows bacteria to detect and respond to environmental changes, similar to the role of membrane fluidity sensors in other bacteria?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.