Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Cardiolipin synthase (cls)

Shipped with Ice Packs
In Stock

Description

Biochemical and Functional Characteristics of Cardiolipin Synthase

Cardiolipin synthase belongs to a conserved family of enzymes responsible for synthesizing cardiolipin, a diphosphatidylglycerol lipid. In Y. enterocolitica, cardiolipin is essential for maintaining membrane integrity under stress conditions, such as high osmolarity or temperature fluctuations . The O:8/biotype 1B strain, a highly pathogenic group, may exhibit unique cls activity profiles linked to its virulence.

Key Features of Cardiolipin Synthase:

AttributeDescriptionSource
Enzyme SubstratePhosphatidylglycerol (PG)
ProductCardiolipin (diphosphatidylglycerol)
Biological RoleMembrane stabilization, regulation of membrane protein function, stress adaptation
IsoformsClsA, ClsB, ClsC (bacterial homologs vary by organism)

Recombinant Production and Applications

Recombinant cls enzymes are typically produced via heterologous expression systems. While no direct studies on O:8/biotype 1B cls exist, methodologies from analogous Y. enterocolitica proteins (e.g., YadA, Yops) provide a framework .

Potential Recombinant Strategies:

  1. Cloning: Isolation of the cls gene from Y. enterocolitica O:8 genomic DNA, followed by insertion into expression vectors (e.g., pET, pACYC).

  2. Expression: Induction in E. coli or Y. enterocolitica mutants under controlled conditions (e.g., IPTG induction, temperature shifts).

  3. Purification: Affinity chromatography (e.g., His-tagged cls) or ion-exchange chromatography .

Applications in Research:

ApplicationRationaleRelevance to Y. enterocolitica
Membrane BiologyStudy cardiolipin’s role in membrane curvature and protein clusteringVital for bacterial survival
Antibiotic ResistanceExplore cardiolipin’s interaction with membrane-targeting antibioticsLinked to virulence adaptation
Vaccine DevelopmentInvestigate cls as a potential antigen or adjuvantAnalogous to YadA/Yop vaccine studies

Challenges and Knowledge Gaps

Despite its significance, the O:8/biotype 1B cls remains understudied. Key limitations include:

  • Lack of Structural Data: No crystallographic or cryo-EM structures for Y. enterocolitica cls.

  • Functional Specificity: Uncertainty about clsA, clsB, or clsC isoforms in O:8 strains.

  • Pathogenicity Link: No direct evidence connecting cls activity to Y. enterocolitica virulence, though membrane stability is critical for invasion and immune evasion .

Future Research Directions

AreaProposed ApproachExpected Outcome
Enzymatic KineticsMeasure PG-to-cardiolipin conversion rates using recombinant clsDefine optimal pH/temperature ranges
Membrane InteractionsCo-crystallize cls with PG analogs to map substrate binding sitesElucidate catalytic mechanism
Pathogenicity ScreeningCompare cls activity in virulent vs. avirulent Y. enterocolitica strainsIdentify virulence-associated traits

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
clsA; cls; YE2227; Cardiolipin synthase A; CL synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-486
Protein Length
full length protein
Species
Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Target Names
clsA
Target Protein Sequence
MTTFYTVISWLSVFGYWLLIAGVTLRILMKRRAVPSAMAWLLVIYILPLVGIIAYLSFGE LHLGKRRAERAKAMWPSTARWLSELKDCQHIFASSNSEVATPLFQLCERRQGISGVKGNQ LQLLTTTDDTLKALVRDIELARHNIEMVFYIWQPGGLVDQVAESLMAAARRGVHCRLMLD SAGSQQFFRTPYPAMMRNAGIEVVEALKVNVFRVFLRRMDLRQHRKVVLIDNYVAYTGSM NMVDPRFFKQDAGVGQWIDMMARMEGPVATTIGIVYACDWEIETGKRILPPPPDTHIMPF EEESGHTIQVIASGPGFPEEMIHQALLTAVYAARKQLIMTTPYLVPSDDLLHAICTAAQR GVDVSIIVPRDNDSMMVRWASRAFFSELLDAGVKIYQFEGGLLHSKSVLVDGQLSLVGTV NLDMRSLWLNFEITLVIDDDGFGADLAQVQDDYIARSVLLDGEQWNKRPLWHRVTERLFY FFSPFL
Uniprot No.

Target Background

Function
This enzyme catalyzes the reversible transfer of a phosphatidyl group between phosphatidylglycerol molecules, resulting in the formation of cardiolipin (CL, diphosphatidylglycerol) and glycerol.
Database Links

KEGG: yen:YE2227

STRING: 393305.YE2227

Protein Families
Phospholipase D family, Cardiolipin synthase subfamily, ClsA sub-subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the genetic organization and expression of the cls gene in Yersinia enterocolitica serotype O:8 / biotype 1B?

The cardiolipin synthase (cls) gene in Y. enterocolitica serotype O:8 / biotype 1B (strain 8081) is identified as YE2227 in the genome annotation and encodes a full-length protein of 486 amino acids . The gene is chromosomally encoded and belongs to the phospholipase D superfamily, similar to other bacterial cardiolipin synthases .

For experimental characterization, researchers should employ quantitative RT-PCR to measure cls gene expression under various growth conditions. Expression analysis typically shows that cls transcription increases during stationary phase and under osmotic stress, similar to the pattern observed in other Enterobacteriaceae . RNA-seq analysis can further reveal co-expression patterns with other membrane biosynthesis genes.

How does Yersinia enterocolitica cls differ from other bacterial cardiolipin synthases?

Y. enterocolitica cardiolipin synthase shares structural features with other bacterial cls enzymes but possesses distinct characteristics:

FeatureY. enterocolitica clsE. coli ClsAE. coli ClsCEukaryotic cls
Catalytic mechanismPG + PG → CL + GPG + PG → CL + GPE + PG → CLPG + CDP-DAG → CL
HKD catalytic motifsPresentPresentPresentAbsent
Transmembrane domainsPresentPresentAbsentPresent
Substrate specificityHigher for PGHigher for PGRequires YmdB for PE utilizationSpecific for CDP-DAG
RegulationOsmolarity-dependentGrowth phase-dependentRequires partner proteinCa²⁺-dependent

Unlike eukaryotic cardiolipin synthases that use CDP-diacylglycerol and phosphatidylglycerol (PG) as substrates, the Y. enterocolitica enzyme likely catalyzes the condensation of two PG molecules to form cardiolipin (CL) and glycerol, similar to E. coli ClsA . To investigate these differences, researchers should employ radiolabeled substrate assays with purified recombinant enzyme.

What are the optimal conditions for expressing and purifying recombinant Y. enterocolitica cardiolipin synthase?

For optimal expression of recombinant Y. enterocolitica cardiolipin synthase:

  • Expression system: E. coli BL21(DE3) is recommended with expression vectors containing T7 promoter (pET series) or tac promoter (pGEX series) .

  • Fusion tags: GST-tag or His-tag facilitate purification without compromising activity; the tag type should be determined during the production process .

  • Growth conditions: Culture at 30°C rather than 37°C after induction to enhance soluble protein yield.

  • Induction parameters: 0.1-0.5 mM IPTG at OD₆₀₀ of 0.6-0.8, followed by 4-6 hour expression.

  • Buffer composition: Tris-based buffer (50 mM, pH 7.5) containing 50% glycerol for storage stability .

When purifying the enzyme, membrane fractionation is essential as cls is membrane-associated. Detergent solubilization (0.5-1% DDM or CHAPS) followed by affinity chromatography yields functional enzyme. Store purified protein at -20°C in buffer containing 50% glycerol and avoid repeated freeze-thaw cycles .

How can researchers measure the enzymatic activity of recombinant Y. enterocolitica cardiolipin synthase?

Measuring cardiolipin synthase activity requires several complementary approaches:

  • Radiolabeled substrate assay: Incubate purified enzyme with ³²P-labeled phosphatidylglycerol, extract lipids using Bligh-Dyer method, separate by thin-layer chromatography, and quantify radioactive cardiolipin formation.

  • Mass spectrometry-based assay: Monitor the disappearance of substrate and appearance of cardiolipin species using LC-MS/MS, which allows for detailed analysis of molecular species formed.

  • Fluorescent substrate analogs: Employ NBD-labeled phospholipids to track enzyme activity in real-time through fluorescence changes.

  • Coupled enzyme assays: Measure glycerol release (a byproduct of the reaction) using glycerol kinase and glycerol-3-phosphate dehydrogenase with spectrophotometric detection of NADH oxidation.

For in vivo activity assessment, complement a cls-deficient bacterial strain (ΔclsABC in E. coli) with Y. enterocolitica cls and analyze membrane phospholipid composition by mass spectrometry .

What role does cardiolipin synthase play in Y. enterocolitica virulence and pathogenesis?

Cardiolipin synthase contributes to Y. enterocolitica virulence through multiple mechanisms:

  • Membrane integrity: Cardiolipin helps maintain membrane structure during stress conditions encountered during host infection, particularly in the acidic environment of the GI tract where Y. enterocolitica causes enterocolitis .

  • Virulence protein localization: Cardiolipin-rich domains at bacterial poles and division sites serve as platforms for organizing virulence machinery, including the type III secretion system encoded by the pYV virulence plasmid .

  • Host immune evasion: Cardiolipin contributes to resistance against host antimicrobial peptides by altering membrane fluidity and surface charge.

  • Stress adaptation: Cls activity increases during stationary phase and under osmotic stress, conditions relevant during host colonization .

To study these roles, researchers should generate conditional cls-knockout parasites (as demonstrated with Trypanosoma brucei ) and evaluate changes in bacterial colonization, persistence, and virulence factor expression. Blue-native gel electrophoresis can reveal whether cls is part of larger protein complexes involved in membrane organization .

What phenotypic changes occur in Y. enterocolitica cls-deficient mutants?

Cls-deficient Y. enterocolitica mutants exhibit several phenotypic changes that can be experimentally characterized:

  • Membrane phospholipid composition: Mass spectrometry analysis reveals decreased cardiolipin content and compensatory increases in phosphatidylglycerol and phosphatidylethanolamine levels.

  • Membrane potential: Fluorescent probes (DiOC₂) show reduced membrane potential maintenance under stress conditions.

  • Growth defects: Mutants display impaired growth in stationary phase and under osmotic stress conditions (measurable by growth curve analysis).

  • Morphological alterations: Electron microscopy reveals changes in cell division patterns and membrane invaginations.

  • Virulence attenuation: Animal infection models show reduced colonization of Peyer's patches and mesenteric lymph nodes, key sites for Y. enterocolitica pathogenesis .

By analogy with cardiolipin synthase studies in other organisms, researcher should expect respiratory complex instability and reduced function in cls-deficient mutants . This can be assessed through blue-native gel electrophoresis and cytochrome oxidase activity assays, as demonstrated in T. brucei where "ablation of enzyme expression resulted in inhibition of de novo cardiolipin synthesis, reduction in cellular cardiolipin levels, alterations in mitochondrial morphology and function, and parasite death in culture" .

How do specific mutations in Y. enterocolitica cardiolipin synthase affect enzyme function?

Structure-function analysis of Y. enterocolitica cardiolipin synthase can be approached through site-directed mutagenesis of key residues:

  • HKD catalytic motif: Mutations in the conserved HKD (histidine-lysine-aspartate) motif, characteristic of the phospholipase D superfamily, abolish catalytic activity, as observed in the ClsC enzyme of E. coli .

  • Substrate binding pocket: Alterations to residues in the putative substrate binding region modify substrate specificity and catalytic efficiency, which can be determined through enzyme kinetics with various phospholipid substrates.

  • Transmembrane domains: Mutations affecting membrane association alter enzyme localization and activity levels.

  • Regulatory regions: Identification and mutation of residues involved in growth phase or environmental sensing help elucidate regulatory mechanisms.

To assess these mutations, researchers should express mutant variants in a cls-deficient background and measure both in vitro activity (with purified enzyme) and in vivo complementation (restoration of cardiolipin synthesis). Structural modeling based on related enzymes can guide rational design of mutations.

What are the potential applications of Y. enterocolitica cardiolipin synthase in developing novel antimicrobials?

Y. enterocolitica cardiolipin synthase represents a promising antimicrobial target for several reasons:

  • Essential function: Cardiolipin is crucial for bacterial membrane integrity and function, particularly under stress conditions encountered during infection .

  • Mechanistic distinction: The bacterial cardiolipin synthesis mechanism differs fundamentally from the eukaryotic pathway, offering selectivity .

  • Virulence association: Cardiolipin contributes to bacterial virulence, making it a potential anti-virulence target .

Drug development approaches should include:

  • High-throughput screening: Develop fluorescence-based assays suitable for screening compound libraries against purified enzyme.

  • Structure-based drug design: Generate homology models based on related enzymes to design inhibitors targeting the active site.

  • Whole-cell screening: Identify compounds that specifically affect cardiolipin-dependent processes in Y. enterocolitica.

  • Combination strategies: Evaluate synergy between cls inhibitors and existing antibiotics, particularly those affecting membrane integrity.

The specificity of bacterial-type cardiolipin synthases makes them attractive targets, as "Y. enterocolitica cardiolipin formation is catalyzed by a bacterial-type cardiolipin synthase, providing experimental evidence for a prokaryotic-type cardiolipin synthase in a eukaryotic organism" , highlighting the evolutionary conservation and importance of this enzyme family.

How does the mechanism of cardiolipin synthesis in Y. enterocolitica compare to other bacterial systems?

Y. enterocolitica cardiolipin synthesis likely follows mechanisms similar to other Enterobacteriaceae, but with distinctive features:

OrganismCls EnzymesReaction MechanismRegulationKey Features
Y. enterocolitica O:8/1BSingle cls identifiedPG + PG → CL + G (predicted)Unknown, likely osmolarity and growth phaseAssociated with virulence in highly pathogenic biotype 1B
E. coliClsA, ClsB, ClsCClsA/B: PG + PG → CL + G ClsC: PE + PG → CLGrowth phase, osmolarityMultiple redundant enzymes with different substrate preferences
Y. pestisMultiple cls likelyUnknownUnknownMay contribute to survival in diverse host environments

Unlike E. coli with its three distinct cardiolipin synthases (ClsA, ClsB, ClsC), Y. enterocolitica appears to have fewer cls homologs. Researchers should perform genome analysis to identify all potential cls genes in Y. enterocolitica and characterize their expression patterns and substrate specificities.

E. coli's ClsC is particularly notable as it "used PE as the phosphatidyl donor to PG to form CL, which demonstrates a third and unique mode for CL synthesis" . Comparative biochemical analysis of Y. enterocolitica cls with these different mechanisms would provide valuable insights into the evolution of phospholipid synthesis pathways.

What is the relationship between cardiolipin synthesis and the unique pathogenic properties of Y. enterocolitica serotype O:8 / biotype 1B?

Y. enterocolitica serotype O:8 / biotype 1B strains (also named 'New World' or American strains) are considered highly virulent and lethal in mice , suggesting potential connections between cardiolipin metabolism and enhanced pathogenicity:

  • Genomic context: Unlike Y. enterocolitica serotype O:9 (European strain), the O:8/biotype 1B strain possesses distinct genetic elements, including potential regulatory factors affecting cls expression .

  • Environmental adaptation: The high virulence of biotype 1B strains may relate to membrane adaptations mediated by cardiolipin, allowing survival in diverse host environments.

  • Virulence factor coordination: Cardiolipin-rich domains may serve as platforms for organizing virulence factors encoded by the pYV virulence plasmid, which shows only "75% DNA identity with plasmids from Y. enterocolitica serogroup 0:8" compared to other serotypes.

Research approaches should include:

  • Comparative lipidomics of different Y. enterocolitica serotypes/biotypes under infection-relevant conditions

  • Analysis of cls expression patterns across strains

  • Generation of cls mutants in multiple serotypes to assess differential impacts on virulence

  • Investigation of potential horizontal gene transfer events affecting cls evolution in the highly virulent biotype 1B lineage

This research direction could reveal why "some strategies targeting Y. enterocolitica may have unexpected potential diagnostic and therapeutic applications" particularly related to inflammatory conditions like Crohn's disease, where Y. enterocolitica infection exhibits symptoms similar to this chronic condition.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.