Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Cobalamin biosynthesis protein CobD (cobD)

Shipped with Ice Packs
In Stock

Description

Yersinia enterocolitica Serotype O:8 / Biotype 1B: Pathogen Profile

Yersinia enterocolitica is a bacterial species belonging to the family Enterobacterales that causes various clinical manifestations including enterocolitis, acute diarrhea, terminal ileitis, mesenteric lymphadenitis, and pseudoappendicitis. In severe cases, systemic spread can result in fatal sepsis . Among the various strains, Y. enterocolitica bioserotype 1B/O8 is considered highly pathogenic due to its virulence factors and iron acquisition systems.

The common symptoms of Y. enterocolitica infection include:

  • Diarrhea (sometimes bloody in severe cases)

  • Low-grade fever

  • Abdominal pain (often localizing to the right lower quadrant)

  • Vomiting (present in approximately 15-40% of cases)

Y. enterocolitica serotype O:8 / biotype 1B is particularly noteworthy as it represents the highly pathogenic lineage of this bacterium. Clinical isolates of this bioserotype have been reported in Europe, with a significant emergence in Poland between 2004 and 2008 . These isolates carry major virulence markers and demonstrate strong clonality, suggesting common origins and transmission routes .

Genetic Characteristics and Virulence Factors

The high pathogenicity of Y. enterocolitica biotype 1B is attributed to the yersiniabactin siderophore-mediated iron uptake system . This strain carries several virulence markers including:

  • ystA gene (encoding heat-stable enterotoxin)

  • ail gene (encoding attachment invasion locus protein)

  • myfA gene (encoding Myf fimbriae)

  • irp1 and irp2 genes (part of the yersiniabactin biosynthesis cluster)

  • fyuA gene (encoding siderophore receptor)

These genetic elements collectively contribute to the pathogen's ability to colonize, invade, and cause disease in humans.

Cobalamin Biosynthesis: Metabolic Context

Cobalamin (vitamin B12) is the largest and most structurally complex vitamin, consisting of a modified tetrapyrrole structure called a corrin with a centrally chelated cobalt ion . This essential cofactor is utilized by various enzymes in both prokaryotes and animals, while plants and fungi do not require it.

Cobalamin Biosynthesis Pathways

The biosynthesis of cobalamin involves numerous steps that convert aminolevulinic acid through intermediates like uroporphyrinogen III and adenosylcobyric acid to the final active forms of the vitamin . Two main biosynthetic routes exist:

  1. Anaerobic pathway: Characterized by early incorporation of cobalt

  2. Aerobic pathway: Characterized by late incorporation of cobalt and oxygen requirements

In both pathways, the process involves forming a macrocycle called the corrin ring that coordinates with the cobalt ion. This structure, specifically cobyrinic acid with seven carboxylate groups, undergoes modifications where amide groups replace all but one of the carboxylates, resulting in cobyric acid . The cobalt is then ligated by an adenosyl group, and in the final steps common to all organisms, an aminopropanol sidechain is added to the remaining free carboxylic group, followed by assembly of the nucleotide loop that provides the second ligand for cobalt .

CobD Protein: Structure and Function

The CobD protein plays a specific role in the cobalamin biosynthesis pathway of Y. enterocolitica. Based on the amino acid sequence provided in the product information, the CobD protein from Y. enterocolitica serotype O:8 / biotype 1B consists of 318 amino acids .

Functional Role in Cobalamin Biosynthesis

CobD is specifically involved in the L-threonine O-3-phosphate decarboxylase activity necessary for the synthesis of the aminopropanol moiety that connects the corrin ring to the nucleotide loop in the vitamin B12 structure. This function is critical for completing the assembly of the active cobalamin molecule.

The presence of the CobD protein in Y. enterocolitica serotype O:8 / biotype 1B indicates that this pathogenic bacterium possesses the machinery for de novo cobalamin biosynthesis, potentially contributing to its survival and virulence in host environments where vitamin B12 availability might be limited.

Recombinant CobD Protein: Production and Characteristics

Recombinant production allows for the isolation and study of CobD protein independent of the native organism. The recombinant form of Y. enterocolitica CobD protein is produced in E. coli expression systems with specific modifications to facilitate purification and analysis.

Production and Purification

The recombinant Y. enterocolitica serotype O:8 / biotype 1B CobD protein (product code RFL20347YF) is produced with the following specifications:

ParameterSpecification
SourceE. coli
TagN-terminal His tag
Protein LengthFull Length (1-318 amino acids)
FormLyophilized powder
PurityGreater than 90% as determined by SDS-PAGE
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Storage Conditions-20°C/-80°C, with aliquoting necessary for multiple use
UniProt IDA1JTR6

The His-tag fusion allows for simplified purification using affinity chromatography, enabling high purity isolation of the target protein.

Research Applications of Recombinant CobD

The recombinant CobD protein from Y. enterocolitica serves as a valuable tool for various research applications, including:

Enzymatic Activity Analysis

In vitro assays using the recombinant protein allow for characterization of its enzymatic properties, including:

  • Substrate specificity

  • Kinetic parameters

  • Cofactor requirements

  • Inhibition profiles

Such information is crucial for understanding the protein's role in cobalamin biosynthesis and potentially developing inhibitors targeting this pathway.

Antibody Production

The recombinant protein can be used to generate antibodies for immunological detection of CobD in bacterial samples, enabling studies of protein expression levels under various conditions.

Protein-Protein Interaction Studies

Purified CobD can be employed in pull-down assays, co-immunoprecipitation, or yeast two-hybrid systems to identify interaction partners within the cobalamin biosynthesis pathway or other cellular processes.

Clinical Significance and Therapeutic Potential

Understanding CobD's role in Y. enterocolitica metabolism has important implications for clinical microbiology and infectious disease research.

Diagnostic Applications

The detection of CobD or its encoding gene may serve as a molecular marker for identifying pathogenic Y. enterocolitica strains. Given that highly pathogenic Y. enterocolitica 1B/O8 isolates show strong clonality and share specific virulence traits , genes involved in essential metabolic pathways like cobalamin biosynthesis could serve as targets for diagnostic assays.

Therapeutic Target Potential

Enzymes involved in bacterial-specific metabolic pathways represent attractive targets for antimicrobial development. As cobalamin biosynthesis is absent in humans (who acquire vitamin B12 through diet), inhibitors targeting CobD could potentially offer selective antibacterial activity against Y. enterocolitica with minimal host toxicity.

The emergence of Y. enterocolitica 1B/O8 strains in clinical settings, particularly those showing clonal dissemination as reported in Poland , underscores the need for novel therapeutic approaches. Targeting metabolic pathways essential for bacterial survival represents one such strategy.

Product Specs

Form
Supplied as a lyophilized powder.

Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes if you have specific requirements. We will fulfill requests to the best of our ability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and confirmed in advance. Additional fees will apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline for your reconstitution.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.

The tag type is finalized during production. If you require a specific tag, please inform us; we will prioritize fulfilling your request.
Synonyms
cobD; YE2724; Cobalamin biosynthesis protein CobD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-318
Protein Length
full length protein
Species
Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Target Names
cobD
Target Protein Sequence
MTLSAWFVAFLLDHWLGDPPRWPHPVRWMGNLITLLQRAIRTLCHSEWALKWGGAVLWLL VVGITWLVSWGFLWLMTEINPWLGWLAQVWMIYTLLAGRCLSDAALAVFDALQHGTLAQS REKLSWIVGRDTSQLEKPQITRAVVETVAENSVDGVIAPLFFLMLGGAPLAMAYKAVNTL DSMVGYKTPKYRAIGYMSARMDDLANWLPARLSWVLLSAAAWLIQADYRQALRIGWRDRY QHSSPNCAWSEATVAGALGIRLGGPNDYCGERVEKPWIGDERREVALSDIPRSIHLMMMA SLLALLLFALTHLLLVGI
Uniprot No.

Target Background

Function

Function: Catalyzes the addition of aminopropanol to the F carboxylic group of cobyric acid, converting it to cobinamide.

Database Links

KEGG: yen:YE2724

STRING: 393305.YE2724

Protein Families
CobD/CbiB family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is CobD protein and what is its role in cobalamin biosynthesis?

CobD is a key protein involved in the cobalamin (vitamin B12) biosynthesis pathway in various bacteria, including Yersinia enterocolitica serotype O:8 / biotype 1B. Specifically, it functions within the corrin ring biosynthesis group of proteins, which are essential for constructing the core structure of cobalamin molecules . The protein is part of a complex biosynthetic pathway that involves multiple enzymes working in concert to produce this essential cofactor. In the broader metabolic context, cobalamin serves as a critical enzyme cofactor for numerous biochemical reactions across most branches of life, making the study of its biosynthesis proteins particularly important for understanding microbial metabolism and potential therapeutic interventions .

How is the recombinant version of this protein produced?

The recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Cobalamin biosynthesis protein CobD is typically produced using standard molecular cloning and protein expression techniques. The process generally involves:

  • Isolation of the cobD gene from Yersinia enterocolitica serotype O:8 / biotype 1B genomic DNA

  • Cloning into an appropriate expression vector with a His-tag or other purification tag

  • Transformation into a suitable expression host (often E. coli)

  • Induction of protein expression under optimized conditions

  • Cell lysis and protein purification via affinity chromatography

Commercial versions of this protein, such as those referenced in the search results, typically contain the full-length protein (amino acids 1-318) with a His-tag to facilitate purification . The expression and purification methods must be optimized to ensure proper folding and activity of the final protein product.

Why is Yersinia enterocolitica serotype O:8 / biotype 1B specifically used for studying CobD?

Yersinia enterocolitica serotype O:8 / biotype 1B is frequently used as a model organism for studying pathogenic bacteria. This particular serotype and biotype combination has several advantages for research:

  • It represents a well-characterized pathogenic strain with established virulence factors

  • The strain's complete genome has been sequenced, facilitating genetic studies

  • The cobalamin biosynthesis pathway in this organism is representative of the process in other bacteria

  • This specific serotype demonstrates unique survival characteristics that make it valuable for comparative studies

Research has shown that Y. enterocolitica serotype O:8 has distinct viability profiles in different experimental conditions, including varying sensitivity to plasma factors and temperature, making it a versatile model for studying bacterial survival mechanisms alongside metabolic pathways like cobalamin biosynthesis .

What are the optimal storage and handling conditions for recombinant CobD protein?

For optimal results when working with recombinant CobD protein from Y. enterocolitica, researchers should follow these evidence-based storage and handling protocols:

ParameterRecommended ConditionNotes
Storage temperature-80°C (long-term)
-20°C (medium-term)
Avoid repeated freeze-thaw cycles
Working temperature4°CKeep on ice during experiments
Buffer composition50 mM Tris-HCl, pH 7.5
150 mM NaCl
10% glycerol
May vary based on specific applications
Additives for stability1 mM DTT or 5 mM β-mercaptoethanolProtects cysteine residues from oxidation
Recommended aliquot size20-50 μLMinimizes freeze-thaw damage

When working with this protein, it's important to monitor its stability through activity assays or structural analysis methods like circular dichroism. Similar to observations with other Y. enterocolitica components, the protein's activity can be affected by heat-labile factors, so temperature control during experiments is crucial .

How can I design experiments to assess CobD function in cobalamin biosynthesis?

To effectively assess CobD function in the cobalamin biosynthesis pathway, consider these methodological approaches:

  • Enzymatic activity assays: Design in vitro assays that measure the conversion of specific substrates to products catalyzed by CobD. This typically involves spectrophotometric detection of reaction products or HPLC analysis of metabolite profiles.

  • Genetic complementation studies: In systems where the cobD gene has been knocked out, introduce the recombinant protein to assess restoration of cobalamin biosynthesis. Measurement of cobalamin production using methods similar to those described in metagenome-based studies can provide quantitative data on functional complementation .

  • Protein-protein interaction analyses: Investigate interactions between CobD and other proteins in the cobalamin biosynthesis pathway using techniques such as co-immunoprecipitation, yeast two-hybrid assays, or protein crosslinking.

  • Structural studies: Employ X-ray crystallography or NMR to determine the structure-function relationships of CobD, particularly focusing on active site residues and substrate binding pockets.

For comprehensive analysis, integrate multiple approaches to build a complete picture of CobD function. For example, researchers studying cobalamin in soil samples employed both metagenomic analysis of biosynthesis genes and direct measurement of cobalamin forms to establish correlations between genetic potential and actual metabolite production .

What controls should be included when working with recombinant CobD in experimental settings?

Robust experimental design for studies involving recombinant CobD protein should include the following controls:

Positive controls:

  • Commercially available CobD with verified activity

  • Known functional homologs from related organisms

  • Purified native CobD protein (if available)

Negative controls:

  • Heat-inactivated CobD protein (56°C for 30 minutes often used to inactivate proteins while preserving structure)

  • Catalytically inactive CobD mutants (site-directed mutagenesis of active site residues)

  • Buffer-only reactions

Specificity controls:

  • Related proteins from the same biosynthetic pathway to assess cross-reactivity

  • Substrate analogs to evaluate binding specificity

  • Competition assays with known inhibitors

When interpreting results, it's important to consider factors that might affect protein function. Research on Y. enterocolitica has shown that experimental conditions can significantly influence results, with factors like temperature, plasma components, and cellular elements all potentially affecting activity . These variables should be carefully controlled and documented to ensure reproducibility.

How should I analyze metagenomic data related to CobD and other cobalamin biosynthesis proteins?

Metagenomic analysis of CobD and related cobalamin biosynthesis proteins requires a structured bioinformatic approach:

  • Gene identification and annotation: Use profile hidden Markov models (HMMs) to identify and classify genes encoding proteins involved in cobalamin biosynthesis, including CobD. This approach has proven effective in large-scale metagenomic studies of soil samples .

  • Taxonomic profiling: Assign taxonomic classifications to identified sequences to determine which organisms possess the genetic potential for cobalamin biosynthesis. Previous research has shown predominant contributions from Proteobacteria (45.9%), Actinobacteria (24.9%), Firmicutes (6.2%), and other phyla .

  • Pathway completeness assessment: Analyze the presence/absence patterns of genes encoding proteins in different functional groups of the cobalamin biosynthesis pathway:

    • Group A: Corrin ring biosynthesis proteins (including CobD)

    • Group B: Final synthesis and repair proteins

    • Group C: 5,6-dimethylbenzimidazole (DMB) synthase

  • Statistical analysis: Apply appropriate statistical tests (e.g., PERMANOVA, ANOVA) to identify significant differences in gene abundance across different environments or conditions. Soil type, for example, has been shown to significantly influence the composition of potential cobalamin-producing taxa (p < 0.01) .

When interpreting results, consider that less than 10% of soil bacteria and archaea encode the genetic potential for de novo synthesis of cobalamin, highlighting the importance of this function in microbial communities .

What are the challenges in interpreting experimental results from Y. enterocolitica CobD studies?

Interpreting experimental results from Y. enterocolitica CobD studies presents several methodological challenges that researchers should address:

  • Strain-specific variations: Different strains of Y. enterocolitica may exhibit variations in CobD expression and function. When comparing results across studies, carefully consider the specific serotype and biotype used (e.g., serotype O:8 / biotype 1B) .

  • Experimental condition impacts: Research has shown that experimental conditions significantly affect Y. enterocolitica viability and potentially protein function. For example, a 20-minute room-temperature incubation with plasma-containing components resulted in approximately 2 log10 inactivation of Y. enterocolitica (serotype O:8) . These factors must be controlled and reported in detail.

  • Natural versus experimentally manipulated systems: Caution should be exercised when extrapolating from in vitro experiments to natural systems. As noted in blood component studies, there may be "potential differences between naturally infected and experimentally inoculated" samples .

  • Multiple interacting factors: The function of CobD exists within a complex network of metabolic pathways and environmental influences. Interpretation should consider how factors like temperature, pH, nutrient availability, and the presence of other microorganisms might affect experimental outcomes.

To address these challenges, employ multiple complementary methods, include appropriate controls, and clearly document all experimental conditions to ensure reproducibility and proper interpretation of results.

How does CobD function integrate with broader cobalamin-dependent metabolic networks in bacterial communities?

The function of CobD in cobalamin biosynthesis has significant implications for microbial community dynamics and ecosystem function. Advanced research has revealed several key insights:

  • Keystone metabolic function: Cobalamin production serves as a keystone function in microbial communities, with significant correlations observed between cobalamin biosynthesis genes (including cobD) and microbial community size, diversity, and biogeochemical processes . The relatively small percentage of microorganisms capable of de novo cobalamin synthesis (less than 10% in soil communities) suggests that producers play a critical ecological role .

  • Cross-feeding relationships: Producer-consumer dynamics are established around cobalamin, with a much larger proportion of microorganisms encoding cobalamin transport and cobalamin-dependent enzymes rather than biosynthesis genes . This creates complex interdependencies within microbial communities.

  • Metabolite remodeling networks: The enrichment of DMB (5,6-dimethylbenzimidazole) and corresponding synthesis genes relative to corrin ring synthesis genes suggests an important role for cobalamin remodelers in terrestrial habitats . These organisms can transform cobalamin-like compounds into functional cobalamin, maximizing the impact of limited de novo synthesis.

  • Nitrogen cycle connections: Soil nitrogen cycle microorganisms, which are crucial for soil primary production, have been found to either produce or rely on cobalamin . This links cobalamin metabolism to fundamental ecosystem processes.

Understanding these integration points requires systems biology approaches that combine metagenomic, metatranscriptomic, and metabolomic data to develop predictive models of community metabolism centered around cobalamin exchange.

What are the current technical limitations in studying CobD function and how might they be overcome?

Several technical challenges currently limit comprehensive understanding of CobD function, but emerging methods offer potential solutions:

Technical LimitationCurrent ImpactPotential Solutions
Protein instabilityDifficulties in long-term storage and handling of active protein- Structural modifications to enhance stability
- Alternative buffer formulations
- Cryoprotectant optimization
Complex assay systemsChallenges in directly measuring CobD activity in isolation- Development of coupled enzyme assays
- Advanced mass spectrometry detection of reaction intermediates
- Isotope labeling strategies
Limited structural dataIncomplete understanding of structure-function relationships- Cryo-EM analysis of protein complexes
- Computational modeling and molecular dynamics simulations
- Hydrogen-deuterium exchange mass spectrometry
In vivo complexityDifficulty isolating CobD function from interconnected pathways- CRISPR-based precise gene editing
- Optogenetic control of protein expression
- Compartmentalization using synthetic biology approaches
Metagenomic resolutionChallenges in accurately quantifying cobD genes in mixed communities- Long-read sequencing technologies
- Improved HMM models specific to cobD variants
- Single-cell genomics approaches

Advanced researchers are addressing these limitations through interdisciplinary approaches. For example, combining traditional biochemical assays with metagenomic analyses has provided new insights into the distribution and function of cobalamin biosynthesis proteins in diverse environments . Further integration of computational modeling with experimental validation will be essential for fully characterizing CobD function within the broader context of cobalamin metabolism.

How can structural analysis of CobD inform potential biotechnological applications?

Structural analysis of Y. enterocolitica CobD protein can provide critical insights that enable various biotechnological applications:

  • Enzyme engineering: Detailed structural information, particularly about the active site architecture and substrate binding regions, can guide rational design of CobD variants with enhanced catalytic efficiency, altered substrate specificity, or improved stability. This could lead to more efficient production of cobalamin or novel cobalamin derivatives.

  • Inhibitor design: Understanding the structural basis of CobD function could inform the development of specific inhibitors targeting cobalamin biosynthesis in pathogenic bacteria. Given that Y. enterocolitica serotype O:8 is a pathogenic strain, such inhibitors could have potential therapeutic applications .

  • Synthetic biology platforms: Structural knowledge of how CobD interfaces with other enzymes in the cobalamin biosynthesis pathway could enable the creation of synthetic enzyme complexes or metabolons with enhanced productivity. This approach could potentially address the significant proportion of organisms that lack cobalamin synthesis capacity but require this cofactor .

  • Biosensor development: Structural insights could guide the development of protein-based biosensors for detecting pathway intermediates or environmental conditions relevant to cobalamin metabolism. Such biosensors would be valuable for studying cobalamin dynamics in complex microbial communities.

  • Protein production optimization: Understanding the structural determinants of protein stability could inform improved production methods for recombinant CobD, potentially addressing some of the challenges in working with this protein experimentally.

Advanced structure-function analyses should incorporate both static structural data (X-ray crystallography, cryo-EM) and dynamic information (HDX-MS, NMR, molecular dynamics simulations) to provide a comprehensive view of CobD function that can inform these applications.

How is CobD research contributing to our understanding of microbial community interactions?

Research on cobalamin biosynthesis proteins like CobD is providing significant insights into the social dynamics of microbial communities:

  • Producer-consumer relationships: Studies have revealed that only a small subset of microorganisms (less than 10% in soil environments) possess the complete genetic machinery for cobalamin synthesis, while a much larger proportion rely on exogenous cobalamin . This creates dependency relationships that shape community structure and function.

  • Metabolic handoffs and remodeling: The discovery that some organisms specialize in specific parts of the cobalamin pathway, such as DMB synthesis or cobalamin remodeling, reveals sophisticated metabolic cooperation between community members . For example, the enrichment of DMB synthesis genes relative to corrin ring synthesis genes suggests that many organisms may contribute to different aspects of the complete pathway .

  • Biogeochemical implications: Cobalamin-producing microorganisms, which include those expressing CobD, have been shown to significantly correlate with biogeochemical processes in terrestrial ecosystems . This positions cobalamin biosynthesis as a keystone function with ecosystem-level impacts.

  • Taxonomic distribution patterns: Metagenomic analyses have identified predominant cobalamin producers associated with specific phyla (Proteobacteria, Actinobacteria, Firmicutes, Nitrospirae, and Thaumarchaeota), with variations observed across different soil types . This information helps map the distribution of this critical function across microbial communities.

Future research directions should focus on understanding how environmental perturbations affect these community dynamics and whether cobalamin-centered interactions could be leveraged for applications in agriculture, bioremediation, or microbiome manipulation.

What experimental approaches can address data contradictions in CobD functional studies?

When confronted with contradictory data in CobD functional studies, researchers should implement systematic experimental approaches to resolve discrepancies:

  • Standardized experimental conditions: Develop and adhere to standardized protocols for protein expression, purification, and activity assays. Research on Y. enterocolitica has shown that experimental conditions significantly impact results - for example, temperature and the presence of plasma factors can cause up to 2 log10 inactivation . Standardization should include:

    • Consistent buffer compositions

    • Controlled temperature conditions

    • Standardized protein quantification methods

    • Defined substrate concentrations and purity

  • Cross-validation with multiple methods: Apply complementary experimental approaches to verify findings. For example:

    • Combine in vitro biochemical assays with in vivo genetic studies

    • Verify metagenomic findings with direct measurement of metabolites

    • Supplement computational predictions with experimental validation

  • Reproducibility assessment: Implement robust statistical analysis and reproducibility testing, particularly when dealing with complex biological systems. Studies of cobalamin biosynthesis in soil samples employed rigorous statistical approaches (e.g., PERMANOVA, ANOVA) to validate findings across different environmental conditions .

  • Meta-analysis frameworks: Develop frameworks for systematically comparing results across different studies, similar to approaches used in COPD genetics research where meta-analyses helped identify robust associations from contradictory individual studies .

  • Preregistered studies: Consider preregistering experimental designs and analysis plans to reduce bias in interpreting contradictory results.

By systematically addressing contradictions through these approaches, researchers can build a more coherent understanding of CobD function across different experimental contexts and biological systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.