Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Introduction to Yersinia enterocolitica and plsY

Yersinia enterocolitica is a gram-negative enteric bacterium belonging to the Enterobacteriaceae family. It is primarily recognized as a foodborne pathogen capable of causing various clinical manifestations, including self-limiting enteritis, diarrhea, lymphadenitis, and in severe cases, potentially fatal septicemia . The bacterium's pathogenicity is attributed to multiple virulence factors, with its cell surface structures playing particularly significant roles in disease progression and host interaction .

Among the essential components in Y. enterocolitica's cellular machinery is the Glycerol-3-phosphate acyltransferase (plsY), an integral membrane protein encoded by the plsY gene (locus YE3680 in strain 8081) . This enzyme belongs to a widely distributed family of bacterial acyltransferases that catalyze a critical step in membrane phospholipid biosynthesis—specifically, the transfer of acyl groups from acylphosphate to glycerol-3-phosphate, forming lysophosphatidic acid, a precursor to phosphatidic acid .

The recombinant form of plsY from Y. enterocolitica serotype O:8/biotype 1B has gained significant attention in recent years, owing to its potential as a target for novel antimicrobial agents and its utility in understanding the fundamental processes of bacterial membrane formation. As bacterial phospholipid synthesis pathways differ significantly from those in eukaryotes, proteins like plsY represent attractive targets for selective therapeutic intervention.

Conserved Motifs and Catalytic Domains

The catalytic activity of plsY depends on three highly conserved sequence motifs located within its cytoplasmic domains. Each of these motifs plays a distinct role in substrate binding and catalysis, as determined through site-directed mutagenesis studies on homologous proteins :

  1. Motif 1: Contains essential serine and arginine residues critical for catalytic activity

  2. Motif 2: Exhibits characteristics of a phosphate-binding loop, functioning as the binding site for glycerol-3-phosphate

  3. Motif 3: Features conserved histidine and asparagine residues important for enzymatic activity, along with a glutamate residue essential for maintaining the structural integrity of the protein

Mutations in any of these conserved domains significantly impair the catalytic function of plsY, highlighting their importance in the acyltransferase mechanism .

Role in Phospholipid Biosynthesis

Glycerol-3-phosphate acyltransferase (plsY) occupies a pivotal position in bacterial membrane phospholipid biosynthesis. It catalyzes one of the initial and rate-limiting steps in the formation of phosphatidic acid, which serves as the universal precursor for all glycerophospholipids in bacterial membranes . The biosynthetic pathway involving plsY represents the most widely distributed mechanism for initiating phosphatidic acid formation in bacteria.

The complete reaction pathway involves two coordinated steps:

  1. Conversion of acyl-acyl carrier protein (acyl-ACP) to acylphosphate by another enzyme called PlsX

  2. Transfer of the acyl group from acylphosphate to glycerol-3-phosphate by plsY, forming lysophosphatidic acid

This enzyme is officially classified as EC 2.3.1.n3, reflecting its role as an acyltransferase that specifically transfers acyl groups to position 1 of glycerol-3-phosphate .

Substrate Specificity and Catalytic Mechanism

The plsY protein demonstrates specific binding affinity for its two substrates: acylphosphate and glycerol-3-phosphate. The binding of glycerol-3-phosphate occurs at Motif 2, which possesses the structural characteristics of a phosphate-binding loop . Mutations of the conserved glycine residues in this motif to alanines result in significant defects in glycerol-3-phosphate binding, confirming the critical role of this domain in substrate recognition.

The catalytic mechanism involves the transfer of the acyl moiety from acylphosphate to the 1-position of glycerol-3-phosphate, forming lysophosphatidic acid. This reaction is essential for bacterial viability, as it initiates the synthesis of membrane phospholipids necessary for cell growth and division.

Interestingly, plsY activity is noncompetitively inhibited by palmitoyl-CoA, suggesting potential regulatory mechanisms for controlling phospholipid synthesis in bacteria .

Regulation and Integration with Cellular Metabolism

The regulation of plsY activity is integrated with broader cellular metabolic processes, particularly those related to fatty acid synthesis and membrane biogenesis. As a key enzyme in phospholipid biosynthesis, plsY function must be coordinated with cell growth rates and environmental conditions to maintain appropriate membrane composition and integrity.

While specific regulatory mechanisms for Y. enterocolitica plsY have not been fully elucidated, the enzyme's activity is likely influenced by:

  • Substrate availability (acylphosphate and glycerol-3-phosphate)

  • Feedback inhibition by pathway products

  • Transcriptional regulation of the plsY gene

  • Post-translational modifications affecting protein stability or activity

Expression Systems and Purification

Recombinant Y. enterocolitica plsY can be produced using standard protein expression systems, with appropriate modifications to accommodate the challenges associated with membrane protein expression. The recombinant protein is typically tagged to facilitate purification, with the specific tag type determined during the production process .

The purified recombinant protein is typically stored in a Tris-based buffer containing 50% glycerol, optimized to maintain protein stability and activity . For extended storage, the protein should be maintained at -20°C or -80°C, with working aliquots stored at 4°C for up to one week to minimize damage from repeated freeze-thaw cycles.

Table 2: Storage and Handling Conditions for Recombinant Y. enterocolitica plsY

ParameterConditionNotes
Buffer compositionTris-based with 50% glycerolOptimized for protein stability
Long-term storage-20°C or -80°CPrevents protein degradation
Short-term storage4°CFor working aliquots up to one week
Freeze-thaw cyclesMinimizeRepeated cycles reduce activity
Quantity available50 μg (standard); other quantities availableFor research applications

Biochemical Characterization

Characterization of recombinant Y. enterocolitica plsY typically involves assessing:

  1. Protein purity and integrity through SDS-PAGE and Western blotting

  2. Enzymatic activity by measuring the conversion of acylphosphate and glycerol-3-phosphate to lysophosphatidic acid

  3. Kinetic parameters (Km, Vmax) for substrate binding and catalysis

  4. Effects of pH, temperature, and ionic conditions on enzyme activity

  5. Inhibition profiles with various compounds, including palmitoyl-CoA

These characterizations provide valuable insights into the protein's functional properties and potential applications in research and therapeutic development.

Role in Bacterial Pathogenesis

While plsY itself is not traditionally classified as a virulence factor, its essential role in bacterial membrane phospholipid biosynthesis indirectly contributes to the pathogenic potential of Y. enterocolitica. Properly functioning bacterial membranes are prerequisites for many virulence-associated processes, including:

  • Cellular integrity and resistance to host defense mechanisms

  • Proper localization and function of membrane-associated virulence factors

  • Adaptation to changing environmental conditions during infection

  • Formation of biofilms and other protective structures

The serotype O:8/biotype 1B strain of Y. enterocolitica is known to be highly pathogenic, suggesting that understanding the specific characteristics of plsY in this strain may provide insights into its enhanced virulence compared to less pathogenic strains .

Therapeutic Target Potential

The essential nature of plsY in bacterial membrane biosynthesis, coupled with the absence of direct homologs in human cells, positions this enzyme as a promising target for novel antimicrobial development. Inhibitors specifically designed to disrupt plsY function could potentially impair bacterial membrane synthesis without affecting host cells, leading to selective antibacterial activity.

Several features make plsY particularly attractive as a therapeutic target:

  1. Essential role in bacterial viability

  2. Structural differences from mammalian acyltransferases

  3. Accessible binding sites for small molecule inhibitors

  4. Conservation across many bacterial pathogens, suggesting broad-spectrum potential

Research into plsY inhibitors is still in early stages, but the availability of recombinant protein facilitates high-throughput screening and structure-based drug design approaches.

Research Applications

Recombinant Y. enterocolitica plsY serves numerous research applications:

  • Structural studies to elucidate the precise three-dimensional arrangement of the protein

  • Mechanistic investigations of the acyltransferase reaction

  • Comparative analyses of plsY proteins from different bacterial species

  • Development and testing of potential inhibitors

  • Investigation of membrane phospholipid biosynthesis pathways

These applications contribute to our fundamental understanding of bacterial physiology while simultaneously advancing the development of novel antibacterial strategies.

Comparative Analysis with plsY from Other Bacteria

While the plsY protein is widely distributed across bacterial species, variations in sequence and functional properties exist. Comparative analysis of Y. enterocolitica plsY with homologs from other bacteria reveals both conserved features essential for catalytic function and species-specific adaptations.

Table 3: Comparison of Key Features Among Bacterial plsY Proteins

FeatureY. enterocolitica plsYS. pneumoniae plsYOther Bacterial plsY
Membrane topology5 transmembrane segments (predicted)5 transmembrane segments (confirmed)Generally 5-6 transmembrane segments
Conserved motifsThree cytoplasmic motifsThree cytoplasmic motifsThree highly conserved motifs across species
Substrate specificityAcylphosphate and glycerol-3-phosphateAcylphosphate and glycerol-3-phosphateSimilar substrates with varying affinities
InhibitionLikely noncompetitive inhibition by palmitoyl-CoANoncompetitive inhibition by palmitoyl-CoAVariable inhibition profiles
Gene contextplsX-plsY arrangementVariable arrangementsFrequently adjacent to plsX

The comparative analysis highlights the evolutionary conservation of plsY structure and function, reflecting the essential nature of this enzyme in bacterial physiology.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific requirements for the format, please specify your needs when placing your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer composition, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
plsY; YE3680; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-217
Protein Length
full length protein
Species
Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Target Names
plsY
Target Protein Sequence
MSAIALGMIIFAYLCGSISSAVLVCRVAKLPDPREHGSGNPGATNVLRIGGRTAAATVLI FDVLKGMLPVWIAYLLHVSPLYLGLTAIAACLGHIYPVFFHFKGGKGVATAFGAIAPIGW DLTGLMTGTWLLTVLLSGYSSLGAIISALIAPFYVWWFKPQFTFPVAMLSCLILMRHHDN IQRLWRGKESKIWDKLRKKKQKTPAEEAAELEEKEED
Uniprot No.

Target Background

Function
Catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P) to form lysophosphatidic acid (LPA). This enzyme utilizes acyl-phosphate as a fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links

KEGG: yen:YE3680

STRING: 393305.YE3680

Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Yersinia enterocolitica serotype O:8 / biotype 1B and why is it significant in pathogenesis research?

Yersinia enterocolitica is an enteric bacterium capable of causing severe gastroenteritis in humans. The serotype O:8 / biotype 1B strain (such as reference strain 8081) is particularly significant as it represents one of the most virulent variants of Y. enterocolitica. This strain belongs to the highly pathogenic biotype 1B, which is distinguished from less virulent biotypes by its enhanced virulence mechanisms and host adaptation capabilities .

Biotype 1B strains possess a high pathogenicity island (HPI) that encodes yersiniabactin, a siderophore system that contributes significantly to bacterial virulence. Additionally, these strains contain a full complement of virulence factors including the pYV virulence plasmid that encodes the Yersinia outer proteins (Yops) and the type III secretion system (T3SS), crucial for evading host immune responses .

The study of this specific strain provides insights into mechanisms of bacterial pathogenesis and potential targets for therapeutic intervention, making it a valuable model organism in infectious disease research.

What is Glycerol-3-phosphate acyltransferase (plsY) and what role does it play in bacterial physiology?

Glycerol-3-phosphate acyltransferase (plsY) is a critical enzyme in bacterial phospholipid biosynthesis pathways. It catalyzes the transfer of an acyl group from acyl-ACP to glycerol-3-phosphate, forming lysophosphatidic acid, which is a precursor for membrane phospholipid synthesis. This enzymatic reaction represents the first committed step in the de novo phospholipid biosynthesis pathway in bacteria.

In Yersinia enterocolitica and other gram-negative bacteria, plsY plays essential roles in:

  • Membrane biogenesis and maintenance of membrane integrity

  • Adaptation to environmental stresses through modulation of membrane composition

  • Potential contributions to bacterial pathogenesis through involvement in membrane-associated virulence mechanisms

The enzyme is encoded by the plsY gene, identified in the Y. enterocolitica serotype O:8 / biotype 1B genome and cataloged in protein databases with the UniProt accession number A1JQW7 .

How can researchers distinguish between different biotypes of Yersinia enterocolitica for experimental purposes?

Distinguishing between different biotypes of Y. enterocolitica requires a combination of biochemical, molecular, and phenotypic characterization methods:

  • Biochemical testing: Traditional biotyping relies on biochemical reactions such as lipase activity, esculin hydrolysis, indole production, and fermentation of different sugars. Biotype 1B strains show specific biochemical profiles distinguishable from biotypes 1A, 2, and 4.

  • PCR-based methods: Molecular typing using PCR amplification of specific genetic markers can differentiate between biotypes. Research has shown that biotypes 2 and 4 differ from biotypes 1A and 1B in several genetic elements, including regulatory regions of certain genes .

  • β-lactamase expression analysis: Studies have demonstrated differential enzyme activity of chromosomal β-lactamases (particularly BlaB) across biotypes. BlaB shows higher inducibility in biotypes 2 and 4 compared to biotypes 1A and 1B, which can serve as a distinguishing characteristic .

  • Virulence gene profiling: Detection of virulence-associated genes like those encoding Yersinia outer proteins (Yops) can help identify the more pathogenic biotype 1B strains .

  • Whole genome sequencing: For definitive biotype determination, whole genome sequencing followed by comparative genomic analysis provides the most comprehensive characterization.

What methodologies are most effective for expressing and purifying recombinant plsY from Yersinia enterocolitica?

Expressing and purifying recombinant plsY from Y. enterocolitica requires careful optimization due to the membrane-associated nature of this enzyme. Based on current research methodologies, the following approach is recommended:

  • Expression system selection:

    • E. coli BL21(DE3) or similar expression strains are preferred hosts

    • Consider using specialized strains for membrane proteins (C41/C43) if initial expression attempts fail

    • Fusion tags such as His6, MBP, or GST can improve solubility and facilitate purification

  • Vector design considerations:

    • Include an inducible promoter (T7 or arabinose-inducible)

    • Incorporate a fusion tag with a TEV or thrombin cleavage site

    • Optimize codon usage for expression host

    • Consider using specialized vectors like those in the pSMV series, which have shown success with Y. enterocolitica proteins

  • Expression optimization:

    • Test multiple induction conditions (temperature, inducer concentration, duration)

    • Lower temperatures (16-25°C) often improve membrane protein solubility

    • Consider expression in the presence of glycerol to stabilize the protein

  • Purification strategy:

    • Initial capture using affinity chromatography based on fusion tag

    • Intermediate purification using ion exchange chromatography

    • Final polishing step using size exclusion chromatography

    • For functional studies, consider detergent screening to maintain enzymatic activity

  • Quality control assessment:

    • SDS-PAGE and Western blotting to confirm purity and identity

    • Mass spectrometry to verify protein sequence

    • Enzymatic activity assays to confirm functional state

This methodology has been adapted from successful approaches used with other Yersinia recombinant proteins and should be optimized specifically for plsY .

What role might plsY play in the virulence mechanisms of Yersinia enterocolitica, and how can this be experimentally investigated?

While direct evidence linking plsY to virulence in Y. enterocolitica is limited, its role in membrane biogenesis suggests potential contributions to pathogenesis that can be investigated through several experimental approaches:

  • Gene knockout and complementation studies:

    • Generate plsY deletion mutants using CRISPR-Cas9 or homologous recombination

    • Assess virulence in appropriate infection models

    • Complement with wild-type and site-directed mutants to verify phenotypes

    • Consider using plasmid systems like pSMV13, which has shown success in expressing virulence factors in Yersinia species

  • Protein-protein interaction studies:

    • Identify potential interactions between plsY and known virulence factors

    • Use techniques such as bacterial two-hybrid systems, co-immunoprecipitation, or cross-linking

    • Focus particularly on interactions with Yersinia outer proteins (Yops), which are key immunomodulatory factors

  • Membrane composition analysis:

    • Compare membrane phospholipid profiles between wild-type and plsY-modulated strains

    • Investigate how changes in membrane composition affect T3SS assembly and function

    • Use lipidomics approaches to characterize membrane alterations

  • Host-pathogen interaction assays:

    • Assess adhesion, invasion, and intracellular survival capabilities

    • Examine immune cell responses to bacteria with altered plsY expression

    • Investigate outer membrane vesicle (OMV) production and composition, as OMVs are important vehicles for delivering virulence factors

  • Animal infection models:

    • Compare colonization and virulence of wild-type versus plsY mutants

    • Assess immune responses and disease progression

    • Consider both gastrointestinal and systemic infection models

This multi-faceted approach would provide comprehensive insights into how plsY potentially contributes to Y. enterocolitica pathogenesis, similar to how researchers have investigated the roles of other bacterial enzymes in virulence .

What strategies can be used to investigate plsY gene regulation in different environmental conditions?

Investigating plsY gene regulation requires systematic approaches to identify regulatory elements and environmental factors affecting expression:

  • Promoter analysis and transcription start site (TSS) mapping:

    • 5' RACE to identify transcription start sites

    • In silico analysis to predict potential regulatory elements

    • Focus on regions corresponding to positions -30, -37, and -58 from the transcription start site, as these positions showed variations in the blaB promoter region across biotypes

  • Reporter gene fusions:

    • Construct transcriptional fusions of the plsY promoter with reporter genes (GFP, luciferase)

    • Measure expression under various environmental conditions

    • Create promoter truncations to identify essential regulatory elements

  • Environmental condition screening:

    • Test expression under varying temperatures (25°C, 37°C)

    • Examine effects of pH variation (pH 5.5-8.0)

    • Assess impact of nutrient limitation (iron, carbon, nitrogen)

    • Investigate host-relevant signals (bile salts, antimicrobial peptides)

    • Monitor expression during different growth phases

  • Transcription factor identification:

    • Perform DNA-protein interaction assays (EMSA, DNase footprinting)

    • Conduct chromatin immunoprecipitation (ChIP) to identify regulatory proteins

    • Use yeast one-hybrid screening to discover novel transcription factors

  • Real-time expression monitoring:

    • Implement qRT-PCR protocols to measure relative expression levels

    • Design primers that account for potential sequence variations between biotypes

    • Include appropriate reference genes for normalization

    • Calculate fold changes using methods similar to those employed in biotype-specific studies of blaB

This comprehensive approach will help elucidate the regulatory mechanisms controlling plsY expression and how they might differ between biotypes or environmental conditions.

How can researchers effectively design knockout and complementation studies for plsY in Yersinia enterocolitica?

Designing effective knockout and complementation studies for plsY requires careful consideration of the gene's essential nature and potential polar effects:

  • Knockout strategy design:

    • Consider that plsY may be essential; use conditional knockout approaches

    • Design temperature-sensitive alleles or inducible antisense systems

    • Use CRISPR interference (CRISPRi) for tunable gene repression

    • Implement counterselectable markers for clean deletions

    • Design primers that consider genomic context to avoid polar effects

  • Complementation system development:

    • Use plasmid systems with demonstrated efficacy in Yersinia, such as the Asd⁺ plasmid pSMV13

    • Implement inducible promoters for controlled expression levels

    • Include epitope tags for protein detection while ensuring they don't interfere with function

    • Design multiple complementation constructs with varying expression levels

  • Experimental validation approaches:

    • Confirm genetic modifications by PCR, sequencing, and Southern blotting

    • Verify protein expression changes by Western blotting

    • Assess membrane phospholipid composition changes via lipidomics

    • Measure growth kinetics under various conditions

    • Evaluate stress responses and antibiotic susceptibilities

  • Phenotypic characterization:

    • Design assays for membrane integrity (dye exclusion, permeability)

    • Assess cell morphology changes using microscopy

    • Measure virulence-associated phenotypes (motility, biofilm formation)

    • Evaluate host cell interaction phenotypes (adhesion, invasion)

    • Test colonization ability in appropriate animal models

  • Data analysis considerations:

    • Use appropriate statistical methods for comparing phenotypes

    • Implement controls for plasmid maintenance and expression level variations

    • Consider growth defects when interpreting virulence phenotypes

    • Account for potential compensatory mechanisms in knockout strains

This systematic approach ensures rigorous assessment of plsY function while accounting for technical challenges inherent in studying potentially essential genes.

What techniques are most suitable for studying the interaction between plsY and the Yersinia type III secretion system?

Investigating potential interactions between plsY and the type III secretion system (T3SS) requires specialized approaches given the complexity of these bacterial nanomachines and the membrane-associated nature of plsY:

  • Co-immunoprecipitation and pull-down assays:

    • Generate antibodies against plsY or use epitope-tagged versions

    • Pull down protein complexes under native conditions

    • Identify interacting proteins by mass spectrometry

    • Validate interactions with reciprocal pull-downs

    • Focus on potential interactions with components of the T3SS basal body, which is embedded in the bacterial membrane

  • Bacterial two-hybrid systems:

    • Clone plsY and T3SS components into appropriate vectors

    • Screen for protein-protein interactions in a bacterial host

    • Confirm positive interactions with independent methods

    • Map interaction domains through truncation analysis

  • Membrane composition analysis:

    • Compare lipid profiles between wild-type and plsY-modulated strains

    • Focus on membrane microdomains where T3SS complexes localize

    • Use lipidomics and membrane fractionation techniques

    • Correlate membrane composition changes with T3SS functionality

  • Fluorescence microscopy approaches:

    • Create fluorescent protein fusions to visualize co-localization

    • Implement super-resolution techniques for detailed spatial analysis

    • Use FRET or FLIM to detect direct protein interactions

    • Perform time-lapse imaging to monitor dynamic interactions

  • T3SS functional assays:

    • Assess T3SS assembly in strains with altered plsY expression

    • Measure Yop translocation efficiency into host cells

    • Evaluate needle complex formation by electron microscopy

    • Quantify secretion of T3SS effectors under inducing conditions

  • Outer membrane vesicle (OMV) analysis:

    • Compare OMV production between wild-type and plsY-modified strains

    • Characterize OMV lipid and protein composition

    • Assess incorporation of T3SS components into OMVs

    • Evaluate the immunomodulatory properties of OMVs

This multi-technique approach will provide comprehensive insights into how plsY potentially influences T3SS function through direct interactions or indirect effects on membrane properties.

How should researchers analyze and interpret enzyme kinetics data for recombinant plsY?

Proper analysis and interpretation of enzyme kinetics data for recombinant plsY requires rigorous approaches to address the unique characteristics of membrane-associated enzymes:

  • Kinetic parameter determination:

    • Collect initial velocity data across a range of substrate concentrations

    • Fit data to appropriate enzyme kinetic models (Michaelis-Menten, Hill, etc.)

    • Calculate key parameters (Km, Vmax, kcat, kcat/Km) using non-linear regression

    • Consider using software packages like GraphPad Prism or R with enzyme kinetics libraries

    • Report 95% confidence intervals for all parameters

  • Detergent and lipid environment considerations:

    • Systematically test multiple detergent types and concentrations

    • Document critical micelle concentration (CMC) for chosen detergents

    • Consider reconstitution in liposomes or nanodiscs for more native-like conditions

    • Report detailed composition of lipid/detergent systems used

    • Compare parameters across different membrane mimetic systems

  • Statistical analysis recommendations:

    • Perform replicate measurements (minimum n=3) for all experimental conditions

    • Apply appropriate statistical tests (ANOVA with post-hoc tests) for comparing conditions

    • Validate that data meet assumptions of parametric tests

    • Consider non-parametric alternatives when assumptions are violated

    • Report effect sizes alongside p-values

  • Comparative analysis framework:

    • Compare kinetic parameters between biotypes using standardized conditions

    • Use rank-biserial correlation or Cohen's d to quantify the magnitude of differences

    • Present data in standardized tables similar to Table 3 from search result :

Enzyme ParameterBiotype 1B M (SD)Other Biotype M (SD)p ValueEffect Size Metric
Km (μM)x.x (x.x)x.x (x.x)0.xxxx.xxx
kcat (s⁻¹)x.x (x.x)x.x (x.x)0.xxxx.xxx
kcat/Km (M⁻¹s⁻¹)x.x (x.x)x.x (x.x)0.xxxx.xxx
  • Validation and controls:

    • Include appropriate positive and negative controls

    • Verify protein quality before each experiment (SDS-PAGE, Western blot)

    • Assess enzyme stability under assay conditions

    • Consider substrate competition assays to confirm specificity

    • Compare results with published data for related enzymes when available

This methodical approach ensures robust kinetic characterization of plsY while accounting for the challenges inherent in studying membrane-associated enzymes.

What statistical approaches should be used when comparing plsY expression or activity across different Yersinia strains?

ParameterStrain 1 M (SD)Strain 2 M (SD)p ValueEffect Size (Cohen's d)
plsY expressionx.x (x.x)x.x (x.x)0.xxxx.xxx
Enzyme activityx.x (x.x)x.x (x.x)0.xxxx.xxx
  • Regression analysis for predictive models:

    • Consider using regression models to identify factors predicting plsY activity

    • Report coefficients with confidence intervals as shown in Table 6 from search result :

PredictorsB95% Confidence Intervalp Value
Lower LimitUpper Limit
Factor 1x.xxxx.xxxx.xxx0.xxx
Factor 2x.xxxx.xxxx.xxx0.xxx

This comprehensive statistical approach ensures robust and transparent comparisons of plsY across different Yersinia strains.

What are common challenges in expressing and purifying functional recombinant plsY, and how can they be addressed?

Membrane proteins like plsY present specific challenges during recombinant expression and purification. Here are common issues researchers encounter and strategies to address them:

  • Low expression yields:

    • Challenge: Membrane protein overexpression often results in protein aggregation or toxicity

    • Solutions:

      • Use specialized E. coli strains designed for membrane proteins (C41/C43, Lemo21)

      • Lower induction temperature (16-20°C) and inducer concentration

      • Try expression as fusion with solubility-enhancing partners (MBP, SUMO)

      • Consider codon optimization for the expression host

      • Test expression in Y. pseudotuberculosis systems like YptbS44, which have shown success with other Yersinia proteins

  • Protein misfolding and inclusion body formation:

    • Challenge: Improper folding leading to inactive protein

    • Solutions:

      • Co-express with molecular chaperones (GroEL/ES, DnaK/J)

      • Include stabilizing ligands or substrates during expression

      • Optimize lysis and purification buffers with appropriate detergents

      • Consider refolding protocols if inclusion bodies cannot be avoided

      • Test multiple detergent and lipid combinations for optimal stability

  • Poor solubilization and extraction:

    • Challenge: Inefficient extraction from membranes

    • Solutions:

      • Screen multiple detergents (DDM, LDAO, LMNG, etc.) at different concentrations

      • Optimize solubilization time, temperature, and buffer composition

      • Consider detergent mixtures for improved extraction

      • Use lipidomics to inform native-like membrane mimetics

      • Try specialized approaches like styrene-maleic acid lipid particles (SMALPs)

  • Enzymatic activity loss during purification:

    • Challenge: Loss of activity during purification steps

    • Solutions:

      • Minimize purification steps and handling time

      • Include glycerol (10-20%) and reducing agents in all buffers

      • Maintain consistent detergent concentration above CMC in all buffers

      • Consider purification in nanodiscs or liposomes for stabilization

      • Test activity frequently during purification process

  • Protein heterogeneity:

    • Challenge: Multiple conformational states or post-translational modifications

    • Solutions:

      • Implement additional chromatography steps (ion exchange, SEC)

      • Analyze by mass spectrometry to identify modifications

      • Consider limited proteolysis to identify flexible regions

      • Use analytical ultracentrifugation to assess oligomeric state

      • Apply thermal stability assays to identify stabilizing conditions

By systematically addressing these challenges, researchers can improve the likelihood of obtaining functional recombinant plsY for subsequent structural and functional studies.

How can researchers troubleshoot inconsistent results when comparing plsY across different Yersinia biotypes?

When investigating plsY across different Yersinia biotypes, researchers may encounter inconsistent results due to various technical and biological factors. Here's a systematic troubleshooting approach:

By systematically addressing these potential sources of variability, researchers can obtain more consistent and reliable comparative data on plsY across different Yersinia biotypes.

What control experiments are essential when studying potential interactions between plsY and virulence mechanisms?

  • Genetic complementation controls:

    • Full complementation: Reintroduce wild-type plsY to knockout strains

    • Partial complementation: Introduce functional mutants with specific defects

    • Negative control: Introduce catalytically inactive plsY

    • Heterologous complementation: Test plsY from non-pathogenic species

    • Expression level control: Verify comparable expression levels between constructs

  • Growth and stress response controls:

    • Standard growth curves in multiple media types

    • Stress response profiling (temperature, pH, oxidative stress)

    • Cell morphology assessment by microscopy

    • Membrane integrity evaluation using permeability assays

    • Metabolic activity measurement using respiration indicators

  • Membrane composition controls:

    • Comprehensive lipidomic analysis of membrane phospholipids

    • Membrane fluidity assessment using fluorescence anisotropy

    • Protein localization in membrane microdomains

    • Outer membrane vesicle (OMV) production quantification

    • Lipopolysaccharide (LPS) profile characterization

  • Type III secretion system (T3SS) controls:

    • Secretion assays under standard inducing conditions

    • Western blotting for T3SS structural components

    • Electron microscopy to visualize needle complexes

    • Yop translocation efficiency into host cells

    • Controls using established T3SS mutants for comparison

  • Host-pathogen interaction controls:

    • Cell type specificity tests (epithelial, macrophage, dendritic cells)

    • Cytotoxicity measurements using multiple methods

    • Immune response profiling (cytokine induction)

    • Comparison with known virulence factor mutants

    • Include non-pathogenic Y. enterocolitica biotype 1A as reference

  • Animal model controls:

    • Bacterial burden quantification in multiple tissues

    • Histopathological examination of infected tissues

    • Immune response characterization (cellular and humoral)

    • Competition assays between wild-type and mutant strains

    • Comparison with established virulence factor mutants

This comprehensive set of controls ensures that any observed relationships between plsY and virulence mechanisms can be attributed correctly and distinguished from general physiological effects on bacterial fitness.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.