Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If a specific tag type is required, please inform us; we will prioritize development to meet your specification.
Synonyms
mscL; YE3893; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-136
Protein Length
full length protein
Species
Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Target Names
mscL
Target Protein Sequence
MSFMKEFREFAMRGNVVDLAVGVIIGAAFGRIVSSLVADIIMPPLGLLLGGVDFKQFHFV LRAAEGNIPAVVMNYGSFIQSVFDFVIVALAIFSAVKLMNKLRREKAEEPAAPPAPTTEE KLLAEIRDLLKAQQQK
Uniprot No.

Target Background

Function

A mechanosensitive ion channel that opens in response to membrane stretch. It is implicated in regulating cellular osmotic pressure.

Database Links

KEGG: yen:YE3893

STRING: 393305.YE3893

Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the predicted structure of Y. enterocolitica serotype O:8 MscL and how does it compare to other bacterial MscL proteins?

The Y. enterocolitica serotype O:8 MscL is predicted to share structural similarities with other bacterial MscL homologs, including those from E. coli, M. tuberculosis, and S. aureus. While no crystal structure specific to Y. enterocolitica MscL has been published, comparative structural analysis suggests it likely forms a homopentameric channel with two transmembrane (TM) helices per subunit, similar to E. coli MscL.

The protein likely contains:

  • An N-terminal amphipathic α-helix located on the cytoplasmic side

  • First transmembrane helix (TM1) that lines the permeation pathway

  • A periplasmic loop with two antiparallel β-sheets

  • Second transmembrane helix (TM2) that flanks the exterior

  • A C-terminal domain forming an α-helical coiled-coil

Based on structural studies of MscL in M. tuberculosis, the permeation pathway is predicted to be funnel-shaped with the narrowest constriction formed by hydrophobic amino acids near the cytoplasmic side . The closed state likely has a pore diameter of approximately 2-3 Å, expanding to >25 Å when fully open .

How does MscL function as a mechanosensitive channel, and what activation mechanisms have been identified?

MscL functions as a tension-sensitive "emergency relief valve" in bacterial membranes, protecting cells from osmotic lysis. The channel opens in response to increased membrane tension during hypoosmotic shock, allowing rapid efflux of cytoplasmic osmolytes.

Activation mechanisms:

  • Membrane tension sensing: MscL directly responds to lateral tension in the lipid bilayer. The threshold tension for activation is close to the lytic limit of bacterial membranes (~10-12 mN/m) .

  • Helix-tilting mechanism: During gating, the transmembrane helices undergo substantial tilting away from the membrane normal. Research on S. aureus MscL suggests a two-step pivoting model:

    • First step: Periplasmic surface expands while channel constriction remains closed

    • Second step: Transmembrane helices undergo further tilting, opening the channel pore

  • Charge-induced activation: Studies have demonstrated that introducing charged residues at specific locations can induce MscL opening in the absence of membrane tension .

Electrophysiological measurements show that MscL has one of the largest conductances among ion channels (~3 nS), allowing passage of not only ions but also small proteins and peptides when fully opened .

What purification strategies yield highest purity and functional integrity for recombinant Y. enterocolitica MscL?

A multi-step purification protocol is recommended for obtaining high-purity, functional MscL:

Step 1: Membrane isolation and solubilization

  • Cell lysis by sonication (5-6 pulses, 30 seconds each at 100 Watts on ice)

  • Membrane fraction isolation by ultracentrifugation (100,000 × g, 1 hour, 4°C)

  • Solubilization with mild detergents (1% n-dodecyl-β-D-maltopyranoside [DDM] or 1% n-octyl-β-D-glucopyranoside [OG])

Step 2: Affinity chromatography

  • For His-tagged constructs: Ni-NTA affinity chromatography

  • For GST-fusions: Glutathione-Sepharose affinity chromatography followed by PreScission protease treatment to cleave off GST

Step 3: Size exclusion chromatography

  • Superdex 75 or 200 column equilibrated with buffer containing 0.05% DDM

  • Typical elution profile shows pentameric assembly (~75-85 kDa for pentamer)

Quality control assessments:

  • SDS-PAGE for purity (>90% is achievable)

  • Western blotting for identity confirmation

  • Functionality testing via liposome reconstitution and patch-clamp analysis

The integrity of purified MscL can be assessed through its ability to bind specific chaperones (if applicable for Y. enterocolitica) and its oligomeric state evaluation by gel filtration analysis .

What methods are most effective for evaluating the mechanosensitive properties of recombinant Y. enterocolitica MscL?

Several complementary approaches can be used to characterize MscL mechanosensitivity:

1. Patch-clamp electrophysiology:
The gold standard for direct functional assessment of MscL activity is patch-clamp analysis using:

  • Giant E. coli spheroplasts expressing recombinant MscL

  • Reconstituted proteoliposomes containing purified MscL

  • Planar lipid bilayers with incorporated MscL

Key parameters to measure:

  • Single channel conductance (expected ~3 nS for MscL)

  • Pressure threshold for activation

  • Open dwell times

  • Subconductance states

2. Fluorescence-based assays:

  • Liposome-based fluorescence dequenching assays using self-quenching fluorescent dyes

  • FRET-based conformational change analysis with strategically placed fluorophores

3. In vivo functional complementation:

  • Expression of Y. enterocolitica MscL in E. coli MscL-knockout strains

  • Assessment of osmotic downshock survival rates as a measure of functional rescue

4. Charge-induced activation:

  • Introduction of charged residues at key positions in the pore

  • Assessment of channel opening in the absence of membrane tension

For rigorous characterization, patch-clamp analysis should be performed with varying membrane tensions to establish pressure-response curves and determine the half-maximal activation pressure (P1/2).

How can researchers analyze MscL oligomeric state and conformational changes during channel gating?

Understanding oligomeric assembly and conformational dynamics is crucial for mechanistic insights:

Oligomeric state determination:

  • Gel filtration chromatography: Analysis under various salt conditions, as MscL homodimers can be dissociated at high ionic strength due to salt bridge contributions to dimerization

  • Cross-linking studies: Chemical cross-linking followed by SDS-PAGE to capture oligomeric assemblies

  • Blue Native PAGE: For analysis of intact membrane protein complexes

  • Electron microscopy: Negative staining or cryo-EM for direct visualization of oligomeric assemblies

Conformational change analysis:

  • Site-directed spin labeling: Combined with electron paramagnetic resonance spectroscopy to monitor distance changes during gating

  • Cysteine accessibility: Using thiol-reactive compounds to probe solvent exposure of specific residues in different conformational states

  • FRET spectroscopy: Using strategically placed donor-acceptor pairs to monitor distance changes during channel activation

  • Molecular dynamics simulations: In silico modeling of channel dynamics based on homology models and experimental constraints

Based on studies with other bacterial MscL proteins, Y. enterocolitica MscL is likely pentameric, although tetrameric assemblies have been observed for S. aureus MscL under specific conditions . Confirming the native oligomeric state is essential for accurate functional interpretation.

How does the expression of MscL in Y. enterocolitica compare between different environmental conditions relevant to infection?

While specific data on Y. enterocolitica MscL expression regulation is limited, reasonable hypotheses can be formulated:

Expected expression patterns:

  • Temperature-dependent regulation: Y. enterocolitica encounters temperature shifts during infection (environmental temperature to 37°C in host). Many virulence factors in Y. enterocolitica show temperature-dependent expression .

  • Osmolarity-dependent expression: MscL expression may increase under high osmolarity conditions as a preparatory mechanism for potential osmotic downshock.

  • Growth phase-dependent expression: Expression patterns likely differ between exponential and stationary growth phases, reflecting changing cellular needs.

Regulatory mechanisms to investigate:

  • Potential regulation by global stress response regulators

  • Possible co-regulation with other membrane stress response systems

  • Transcriptional and post-transcriptional control mechanisms

Experimental approaches to assess expression:

  • qRT-PCR analysis of mscL transcription under varying conditions

  • Western blot analysis of MscL protein levels

  • Transcriptional reporter fusions (mscL promoter-GFP) to monitor expression dynamics

  • RNA-Seq analysis to place mscL in global regulatory networks

Investigating expression patterns could reveal important insights into how MscL function is integrated with virulence mechanisms during infection.

How can recombinant Y. enterocolitica MscL be utilized for controlled molecular delivery into mammalian cells?

The large pore size of MscL (~25 Å when fully open) makes it an excellent candidate for controlled molecular delivery applications:

Methodological approach:

  • Heterologous expression in mammalian cells:

    • MscL can be functionally expressed in mammalian cell membranes while preserving mechanosensitivity

    • Expression can be achieved using standard mammalian expression vectors (pcDNA, pCMV) with appropriate codon optimization

  • Controlled activation methods:

    • Charge-induced activation through introduction of charged residues at specific pore locations

    • Optogenetic control through light-sensitive modifications

    • Chemical triggers using engineered cysteine residues and thiol-reactive compounds

  • Cargo delivery assessment:

    • Fluorescently labeled molecules of various sizes to determine size exclusion limits

    • Functional biomolecules (peptides, small proteins, nucleic acids)

    • Cell-impermeable bioactive compounds

Potential research applications:

  • Delivery of membrane-impermeable drugs into cells

  • Introduction of specific markers for live-cell imaging (e.g., phalloidin for actin filament visualization)

  • Controlled release of signaling molecules or CRISPR components

This approach has been successfully demonstrated with bacterial MscL expressed in mammalian cells, allowing rapid controlled uptake of membrane-impermeable molecules . The Y. enterocolitica serotype O:8 MscL could offer unique properties for specific research applications.

What structural and functional insights can be gained from comparing Y. enterocolitica MscL with MscL proteins from other Yersinia species and pathogenic bacteria?

Comparative analysis of MscL across different bacterial species can provide valuable insights:

Structural comparisons:

  • Sequence conservation analysis: Multiple sequence alignment of MscL proteins from Y. enterocolitica, Y. pestis, Y. pseudotuberculosis, and other pathogenic bacteria to identify:

    • Highly conserved residues likely critical for core functions

    • Variable regions that may confer species-specific properties

    • Potential adaptive changes related to specific environmental niches

  • Structural modeling and analysis:

    • Homology modeling based on available crystal structures

    • Identification of species-specific structural features

    • Analysis of pore-lining residues that influence conductance and selectivity

Functional comparisons:

  • Electrophysiological properties:

    • Comparison of conductance, pressure sensitivity, and gating kinetics

    • Analysis of ion selectivity and permeability to various molecules

    • Evaluation of subconductance states and their stability

  • Osmotic protection efficiency:

    • In vivo complementation studies in MscL-deficient bacteria

    • Comparative survival rates under standardized osmotic shock conditions

    • Analysis of interaction with other mechanosensitive channels (MscS, MscK)

The resulting insights could contribute to understanding bacterial adaptation to different host environments and potentially reveal new targets for antimicrobial development. Comparative analysis could also identify unique features of Y. enterocolitica MscL that correlate with its specific pathogenic lifestyle.

How might Y. enterocolitica MscL be utilized in vaccine development strategies against Yersinia infections?

Given the demonstrated success of recombinant Yersinia proteins in vaccine development, MscL presents an intriguing target for exploration:

Theoretical framework:

  • MscL as a vaccine antigen:

    • Surface accessibility of certain MscL regions

    • High conservation across Yersinia species

    • Essential role in bacterial survival under osmotic stress

  • Potential delivery platforms:

    • Recombinant protein subunit vaccines with appropriate adjuvants

    • DNA vaccines encoding MscL

    • Live attenuated Yersinia strains with modified MscL expression

    • MscL-derived peptide vaccines targeting immunogenic epitopes

Research approaches:

  • Epitope mapping: Identification of immunogenic MscL regions accessible to the immune system

  • Chimeric protein design: Similar to successful approaches with other Yersinia antigens, MscL could be incorporated into chimeric constructs:

    • MscL regions could be fused with established protective antigens (e.g., LcrV, F1)

    • Constructs analogous to the bivalent fusion protein rVE (containing Y. pestis LcrV and YopE)

    • MscL-cholera toxin A2/B chimeras for mucosal delivery, similar to approaches used with LcrV

  • Immune response assessment:

    • Analysis of humoral and cellular immune responses

    • Evaluation of IgG subclass distribution to determine Th1/Th2 balance

    • Measurement of protective efficacy in animal models

Evidence from other Yersinia vaccine studies suggests that balanced activation of both Th1 and Th2 immune responses is optimal for protection . Any MscL-based vaccine strategy would need to be designed to achieve this balanced response.

What are the most promising methods for high-resolution structural determination of Y. enterocolitica MscL in different conformational states?

Understanding the complete gating cycle of MscL requires capturing multiple conformational states:

Current methodological challenges:

  • Membrane protein crystallization difficulties:

    • Detergent selection can significantly affect structure (as seen with S. aureus MscL)

    • Limited stability outside the membrane environment

    • Capturing transient intermediates is technically challenging

  • Conformational heterogeneity:

    • MscL exists in multiple states (closed, subconductance states, fully open)

    • Stabilizing specific conformations requires specialized approaches

Advanced structural approaches:

  • Cryo-electron microscopy (cryo-EM):

    • Single-particle analysis for high-resolution structure determination

    • Advantages: No crystallization required, can capture multiple conformations

    • Methods to stabilize intermediates: Nanodiscs with defined tensions, engineered disulfide bonds

  • X-ray crystallography with innovative stabilization:

    • Conformation-specific antibody fragments (Fabs) as crystallization chaperones

    • Fusion with crystallization-promoting domains

    • Cross-linking approaches to trap specific states

  • Molecular dynamics and integrative modeling:

    • Enhanced sampling techniques to model transitions between states

    • Integration of low-resolution experimental data (SAXS, FRET, EPR) with computational models

    • Machine learning approaches to predict conformational changes

  • Innovative spectroscopic approaches:

    • Solid-state NMR of MscL in native-like lipid environments

    • Time-resolved spectroscopy to capture transition dynamics

    • Mass spectrometry with hydrogen-deuterium exchange to map conformational changes

The ultimate goal would be to achieve a "molecular movie" of the complete gating cycle, providing unprecedented insight into the mechanosensation mechanism of this important bacterial channel.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.