Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes, and we will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. To enhance stability for long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution for storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. For multiple uses, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you have a specific tag type requirement, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
lspA; YE0617; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-169
Protein Length
full length protein
Species
Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Target Names
lspA
Target Protein Sequence
MSKPICSTGLRWLWLAVLVVIVDLSSKQWVMTHFALYESVPLIPFFNLTYAQNFGAAFSF LADKSGWQRWFFAGIAIGISVLLMVLMYRSTAKQRLLNCAYALIIGGALGNLFDRMVHGA VIDFIDFHVNNWHFPTFNIADTAICIGAALVIFEGFISPAEKTAMNKGE
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links

KEGG: yen:YE0617

STRING: 393305.YE0617

Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Lipoprotein signal peptidase (lspA) and what is its role in Yersinia enterocolitica?

Lipoprotein signal peptidase (lspA), also known as Signal peptidase II or SPase II, is an essential enzyme involved in the processing of bacterial lipoproteins. In Yersinia enterocolitica, lspA functions by cleaving the signal peptide from prolipoproteins, which is a critical step in lipoprotein maturation and proper localization to the bacterial membrane. The protein is encoded by the lspA gene (also designated YE0617 in Y. enterocolitica) and plays a significant role in bacterial membrane integrity and potentially in pathogenesis .

How does temperature affect Y. enterocolitica virulence factors and membrane components?

Temperature serves as a key regulatory signal for Y. enterocolitica virulence factors and membrane composition. At 21°C (environmental temperature), Y. enterocolitica lipid A is predominantly hexa-acylated and may be modified with aminoarabinose or palmitate. In contrast, at 37°C (host temperature), the bacterium expresses a unique tetra-acylated lipid A structure resulting from 3′-O-deacylation of the molecule by the lipid A deacylase LpxR .

This temperature-dependent modification of the bacterial membrane is directly linked to the expression and function of multiple virulence factors, including motility systems and invasion capabilities. The bacterium is motile when grown at 21°C but not at 37°C, which correlates with the lipid A acylation pattern .

What expression systems are optimal for producing recombinant Y. enterocolitica lspA?

For laboratory research purposes, E. coli expression systems have been successfully employed to produce recombinant Y. enterocolitica lspA protein. The recombinant protein can be generated with an N-terminal His-tag to facilitate purification and detection. The full-length protein (amino acids 1-169) can be expressed, although membrane proteins like lspA may present challenges due to their hydrophobic domains .

When designing expression constructs, researchers should consider codon optimization for the expression host and the inclusion of appropriate fusion tags that will not interfere with the protein's structure or function.

What purification strategy yields the highest purity for recombinant lspA protein?

A multi-step purification protocol is recommended for recombinant His-tagged lspA:

  • Initial capture using immobilized metal affinity chromatography (IMAC) with Ni-NTA or similar resins

  • Buffer exchange to remove imidazole

  • Additional polishing steps such as size exclusion chromatography if necessary

Using this approach, a purity greater than 90% as determined by SDS-PAGE can be achieved . The purified protein is typically supplied as a lyophilized powder to ensure stability during storage and shipping.

What are the optimal storage conditions for maintaining recombinant lspA activity?

For long-term storage, recombinant lspA protein should be stored at -20°C to -80°C, with aliquoting recommended to avoid repeated freeze-thaw cycles. The protein can be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For enhanced stability, the addition of 5-50% glycerol (final concentration) is recommended .

For working stocks, aliquots can be stored at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided as they can lead to protein denaturation and loss of activity .

What assays can be used to measure lspA enzymatic activity in vitro?

To measure lspA enzymatic activity, researchers can employ several approaches:

  • Fluorogenic peptide substrates: Design peptides containing the recognition sequence with a fluorescent tag that is released upon cleavage

  • HPLC analysis: Monitor the appearance of cleaved products from synthetic prolipoprotein substrates

  • Mass spectrometry: Detect mass shifts in substrates after lspA-mediated cleavage

When designing activity assays, it's important to consider that lspA is a membrane protein, and its activity may require appropriate detergent conditions or membrane mimetics to maintain proper folding and function.

How do mutations in the lspA gene affect Y. enterocolitica virulence?

While the provided search results don't directly address mutations in lspA, we can draw parallels from studies of related lipid-modifying enzymes such as LpxR. Mutations in genes involved in membrane component processing can significantly impact bacterial virulence. For instance, LpxR mutations reduce motility and invasion of eukaryotic cells .

By extension, mutations in lspA would likely affect proper lipoprotein processing, potentially disrupting membrane integrity and the function of membrane-associated virulence factors. A methodological approach to studying lspA mutations would include:

  • Creating defined gene deletions or point mutations

  • Complementation studies to verify phenotype specificity

  • Assessment of membrane lipoprotein profiles

  • Virulence testing in appropriate cell culture and animal models

How does lspA contribute to Y. enterocolitica pathogenesis and host-pathogen interactions?

As a lipoprotein signal peptidase, lspA plays a critical role in processing bacterial lipoproteins, many of which are involved in nutrient acquisition, adhesion, and immune evasion. While the specific contribution of lspA to Y. enterocolitica pathogenesis is not directly detailed in the provided search results, we can infer its importance from related studies.

The lipid modifications of Y. enterocolitica, such as those regulated by LpxR, are known to affect virulence properties including motility and invasion of host cells . Since lspA is involved in processing membrane proteins, disruptions in its function would likely impact these same virulence mechanisms.

A methodological approach to studying lspA's role in pathogenesis would include:

  • Gene knockout studies

  • Transcriptomic and proteomic profiling of membrane components

  • Infection models to assess colonization, invasion, and immune response

What is the relationship between lspA function and the bacterial immune evasion strategies of Y. enterocolitica?

Y. enterocolitica employs several strategies to evade host immune responses, including the modification of its surface components to reduce recognition by host pattern recognition receptors. The temperature-dependent modification of lipid A structure (from hexa-acylated to tetra-acylated) when the bacterium transitions from environmental (21°C) to host temperature (37°C) is a key mechanism for immune evasion .

What are the considerations for designing inhibitors targeting Y. enterocolitica lspA?

When designing inhibitors targeting lspA, researchers should consider:

  • Structural specificity: Target unique features of the bacterial enzyme to avoid cross-reactivity with host proteases

  • Membrane penetration: Design molecules capable of reaching the membrane-embedded active site

  • Resistance mechanisms: Consider potential bacterial adaptations that might confer resistance

  • Delivery systems: Develop strategies to deliver inhibitors across the bacterial outer membrane

Rational drug design approaches would benefit from structural information about lspA, including identification of its catalytic residues and substrate-binding pocket. Comparative analysis with other bacterial signal peptidases could help identify conserved features for broad-spectrum inhibitor development or unique features for species-specific targeting.

How can recombinant lspA be used in vaccine development strategies against Y. enterocolitica?

Recombinant lspA could be utilized in vaccine development through several approaches:

  • Subunit vaccine: Purified recombinant lspA or immunogenic epitopes could serve as antigens

  • Live-attenuated vaccines: Engineered strains with modified lspA activity could potentially maintain immunogenicity while reducing virulence

  • Reverse vaccinology: Epitope mapping of lspA to identify immunogenic regions for targeted vaccine design

  • Adjuvant development: Modified lipoproteins processed by lspA might serve as immune-stimulating adjuvants

When developing such strategies, researchers should evaluate:

  • The conservation of lspA across different Y. enterocolitica serotypes and related pathogens

  • The accessibility of lspA epitopes for antibody recognition

  • The functional neutralization potential of anti-lspA antibodies

  • The protective efficacy in appropriate animal models

How does the temperature-dependent regulation of membrane components interact with lspA function?

Y. enterocolitica exhibits a sophisticated temperature-dependent regulation system for its membrane components. At 21°C, lipid A is hexa-acylated and may be modified with aminoarabinose or palmitate, while at 37°C it is tetra-acylated due to LpxR deacylase activity .

This temperature-regulated membrane remodeling likely affects the microenvironment in which lspA functions. Research questions to explore include:

  • Does lspA activity or substrate specificity change at different temperatures?

  • How do changes in membrane fluidity and composition affect lspA-substrate interactions?

  • Are there temperature-dependent regulatory mechanisms controlling lspA expression or activity?

A methodological approach would include:

  • Enzymatic activity assays at different temperatures

  • Membrane fluidity measurements

  • Transcriptomic and proteomic analyses under different temperature conditions

  • Structural studies of lspA in different membrane mimetics

What are the methodological challenges in studying the structure-function relationship of lspA in the context of bacterial membranes?

Studying membrane proteins like lspA presents several methodological challenges:

  • Protein expression and purification: Maintaining proper folding and activity during purification requires careful selection of detergents or membrane mimetics

  • Structural determination: Traditional techniques like X-ray crystallography can be challenging for membrane proteins; alternatives include cryo-EM or NMR with isotopically labeled proteins

  • In situ activity assays: Measuring enzymatic activity within native-like membrane environments requires specialized approaches

  • Protein-lipid interactions: Determining how specific lipid interactions influence lspA function requires advanced biophysical techniques

To address these challenges, researchers might employ:

  • Nanodiscs or liposomes to reconstitute lspA in membrane-like environments

  • Site-directed mutagenesis to identify critical residues for function

  • Molecular dynamics simulations to predict structural changes under different conditions

  • Cross-linking studies to identify interaction partners in the bacterial membrane

How do the different acylation patterns of Y. enterocolitica lipid A influence the interaction with host immune receptors?

Y. enterocolitica modifies its lipid A structure in response to temperature, which has significant implications for host immune recognition . The tetra-acylated lipid A present at 37°C (host temperature) activates host LPS receptors less efficiently than the hexa-acylated form found at 21°C.

This temperature-dependent modification contributes to the low inflammatory response associated with Y. enterocolitica infections. Research has established that this reduced inflammatory response results from two factors:

  • The anti-inflammatory action of the virulence plasmid-encoded YopP protein

  • The reduced activation of LPS receptors due to LpxR-dependent deacylated LPS

Future research directions could include:

  • Detailed structural analysis of receptor-lipid A interactions

  • Investigation of how these modifications affect downstream signaling pathways

  • Exploration of potential therapeutic strategies targeting these immune evasion mechanisms

How does Y. enterocolitica lspA compare to homologous proteins in other pathogenic bacteria?

Y. enterocolitica lspA belongs to a family of conserved bacterial lipoprotein signal peptidases. When comparing it to homologs in other pathogens, researchers should consider:

  • Sequence conservation and divergence in catalytic domains

  • Substrate specificity differences

  • Responses to environmental signals

  • Contributions to virulence

A methodological approach for comparative analysis would include:

  • Multiple sequence alignments

  • Phylogenetic tree construction

  • Homology modeling based on available structures

  • Functional complementation studies in heterologous systems

What are the differences in lipid modification systems between Y. enterocolitica and other Gram-negative pathogens?

Y. enterocolitica possesses a unique temperature-responsive lipid modification system. Unlike some other Gram-negative bacteria, Y. enterocolitica encodes a lipid A deacylase (LpxR) that is responsible for the tetra-acylated lipid A structure observed at 37°C .

Interestingly, while Y. enterocolitica encodes this LpxR ortholog, genome analysis reveals that Y. pestis and Y. pseudotuberculosis do not encode any gene similar to lpxR . This suggests that Y. enterocolitica has evolved specific mechanisms for host adaptation that differ from its close relatives.

The expression of lpxR in Y. enterocolitica is negatively controlled by regulatory systems including RovA and PhoPQ, which are also involved in the modification of lipid A with aminoarabinose . This complex regulatory network allows for precise control of membrane composition in response to environmental conditions.

SpeciesLpxR HomologTemperature-Dependent Lipid A ModificationKey Regulators
Y. enterocoliticaPresentYes (hexa- to tetra-acylated)RovA, PhoPQ
Y. pestisAbsentDifferent mechanisms-
Y. pseudotuberculosisAbsentDifferent mechanisms-
S. entericaPresent (73% identity to YeLpxR)Present but different pattern-
H. pyloriPresent (20% identity to YeLpxR)Present but different pattern-

This comparative information highlights the specialized nature of Y. enterocolitica's membrane modification systems and provides important context for researchers studying bacterial adaptation mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.