Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Na (+)-translocating NADH-quinone reductase subunit E

Shipped with Ice Packs
In Stock

Description

Functional Role in the NQR Complex

The NQR complex consists of six subunits (NqrA–F) and plays a pivotal role in Y. enterocolitica’s respiratory chain:

  • Catalytic Activity: Transfers electrons from NADH to ubiquinone, generating a sodium gradient used for ATP synthesis .

  • Subunit Interaction: NqrE collaborates with subunits D and F in the second step of quinone reduction, converting ubisemiquinone to ubiquinol .

  • Pathogenicity Link: While not directly studied in the provided sources, NQR complexes in pathogenic bacteria are often associated with survival under host stress conditions, such as acidic pH or oxidative environments .

Research Applications

Recombinant NqrE is primarily utilized in:

  • ELISA Development: Commercial kits employ this subunit to detect Y. enterocolitica-specific immune responses .

  • Vaccine Research: Investigated as a potential antigen for vaccine candidates against yersiniosis, though current applications are restricted to preclinical studies .

  • Structural Studies: His-tagged NqrE facilitates protein-protein interaction analyses and crystallography to map the NQR complex’s architecture .

Comparative Analysis of NQR Subunits

Subunit E’s regulatory role contrasts with other NQR subunits:

SubunitFunctionExpression SystemRecombinant Use
NqrD Binds quinone; stabilizes electron transferE. coliEnzyme activity assays
NqrE Facilitates Na+ translocationE. coliImmunoassays, structural studies
NqrF Mediates NADH oxidationE. coli/BaculovirusVaccine development

Challenges and Future Directions

Current limitations include incomplete data on NqrE’s interaction dynamics within the NQR complex and its direct contribution to Y. enterocolitica virulence. Future studies could explore:

  • Genetic Knockout Models: To assess NqrE’s role in bacterial survival under host-mimicking conditions .

  • Antibiotic Targeting: Screening inhibitors against NqrE to disrupt Na+ homeostasis in pathogenic strains .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
nqrE; YE3216; Na(+-translocating NADH-quinone reductase subunit E; Na(+-NQR subunit E; Na(+-translocating NQR subunit E; NQR complex subunit E; NQR-1 subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-198
Protein Length
full length protein
Species
Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Target Names
nqrE
Target Protein Sequence
MEHYISLFVRAVFVENMALAFFLGMCTFLAVSKKVSTAFGLGIAVTVVLGISVPANNLVY NLVLRDGALVEGVDLSFLNFITFIGVIAAIVQVLEMILDRYFPALYNALGIFLPLITVNC AIFGGVSFMAQRDYNFPESIVYGFGSGIGWMLAIVALAGIREKMKYANVPAGLQGLGITF ITTGLMALGFMSFSGVNL
Uniprot No.

Target Background

Function
The NQR complex catalyzes the reduction of ubiquinone-1 to ubiquinol through two sequential reactions, coupled with the transport of Na(+) ions from the cytoplasm to the periplasm. NqrA to NqrE are likely involved in the second step, the conversion of ubisemiquinone to ubiquinol.
Database Links

KEGG: yen:YE3216

STRING: 393305.YE3216

Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Na(+)-translocating NADH-quinone reductase (Na+-NQR) and what role does it play in bacterial metabolism?

Na+-NQR is a unique respiratory enzyme complex that catalyzes electron transfer from NADH to ubiquinone in the bacterial respiratory chain, coupled with Na+ translocation across the cell membrane. Unlike complex I in mitochondria, Na+-NQR has a completely different architecture and is found exclusively in certain bacteria, including many pathogens like Vibrio cholerae and various Yersinia species . This enzyme couples NADH:ubiquinone oxidoreduction to the translocation of two Na+ ions across the cytoplasmic membrane, generating an electrochemical gradient essential for cellular energy production .

The Na+-NQR complex contains a distinct set of cofactors including one flavin adenine dinucleotide (FAD), two covalently bound flavin mononucleotides (FMNs), one riboflavin, and two iron-sulfur centers that facilitate the electron transfer process . This respiratory enzyme plays a crucial role in energy metabolism and adaptation to various environmental conditions, offering bacteria an alternative to H+-based energy conservation systems.

What is the composition of the Na+-NQR complex and what is the specific role of subunit E?

The Na+-NQR complex consists of six subunits designated NqrA, NqrB, NqrC, NqrD, NqrE, and NqrF. Each subunit plays a specific role in the electron transfer and ion translocation processes. Subunit E (NqrE) works in conjunction with subunit D to form a unique intramembranous [2Fe-2S] cluster that is critical for the function of the enzyme .

NqrE is embedded in the membrane and participates in the formation of the sodium transport channel. The [2Fe-2S] cluster between NqrD and NqrE plays a pivotal role in orchestrating the conformational changes that couple electron transfer to Na+ translocation . The redox state of this cluster appears to control the release of Na+ from a binding site located in subunit NqrB, making subunit E essential for the ion pumping function of the complex.

How is recombinant Na+-NQR subunit E typically produced and what challenges are associated with its expression?

Recombinant production of Na+-NQR subunit E typically involves cloning the corresponding gene into expression vectors suitable for bacterial hosts, most commonly E. coli. The expression and purification of Na+-NQR subunits present unique challenges due to their membrane-associated nature and the presence of multiple cofactors.

Based on similar approaches used for other Yersinia proteins, successful recombinant production often requires:

  • Optimization of expression conditions, including temperature, induction time, and inducer concentration. For example, expression at lower temperatures (27°C vs. 37°C) has been shown to improve solubility of Yersinia proteins .

  • Selection of appropriate expression vectors and host strains. BL21 pLysS has been successfully used for expressing Yersinia proteins .

  • Purification strategies often involve a combination of ion exchange and size exclusion chromatography to achieve high purity without the use of affinity tags that might interfere with protein function .

A significant challenge in producing functional Na+-NQR subunit E is the need for proper assembly with other subunits and correct incorporation of the [2Fe-2S] cluster, which requires specific maturation factors.

What maturation factors are required for functional assembly of Na+-NQR complexes containing subunit E?

The maturation of Na+-NQR complexes requires at least two specific maturation factors that have been identified: ApbE and NqrM.

ApbE is a flavin transferase that catalyzes the covalent attachment of flavin mononucleotide (FMN) residues to certain Na+-NQR subunits . This post-translational modification is essential for the electron transport function of the complex.

NqrM (previously designated as DUF539) is another critical maturation factor that is required for the assembly of functional Na+-NQR. This protein contains a single putative transmembrane α-helix and four conserved cysteine residues . Research has demonstrated that mutation of one of these residues (Cys33 in Vibrio harveyi NqrM) completely prevented Na+-NQR maturation, while mutations in other cysteine residues merely decreased the yield of mature protein .

NqrM is presumed to be involved in the delivery of iron to form the (Cys)4[Fe] center between subunits NqrD and NqrE, which is crucial for the [2Fe-2S] cluster formation . Expression of the nqr operon alone, or even with the associated apbE gene, in heterologous hosts like E. coli (which lacks its own Na+-NQR) results in an enzyme incapable of Na+-dependent NADH oxidation. Full functionality is only restored when these genes are coexpressed with the nqrM gene .

How do conformational changes in Na+-NQR affect ion translocation, and what role does subunit E play in this process?

Recent structural studies have revealed that ion pumping in Na+-NQR is driven by large conformational changes that couple electron transfer to ion translocation . Cryo-EM and X-ray structures of Na+-NQR have captured snapshots of the catalytic cycle, showing how the redox state of the intramembranous [2Fe-2S] cluster orchestrates the movements of subunit NqrC, which acts as an electron transfer switch .

The unique [2Fe-2S] cluster formed between NqrD and NqrE appears to play a central role in this mechanism. When this cluster changes its redox state during electron transfer, it triggers conformational rearrangements that control the release of Na+ from a binding site located in subunit NqrB . Thus, subunit E, as part of this cluster, is directly involved in the conformational dynamics that drive ion pumping.

The electron transfer pathway in Na+-NQR is also unique, as electrons from NADH are shuttled twice across the membrane to reach ubiquinone . This complex electron transfer route allows for the coupling with Na+ translocation, making the process energetically efficient.

What approaches are most effective for studying the structure-function relationship of recombinant Na+-NQR subunit E?

Several complementary approaches have proven effective for studying the structure-function relationship of Na+-NQR subunits:

  • Small-angle X-ray scattering (SAXS): This technique has been successfully applied to analyze the solution structure of proteins, revealing information about oligomeric states and binding of allosteric effectors . SAXS could be used to study conformational changes in Na+-NQR subunit E under different conditions.

  • Cryo-electron microscopy (cryo-EM): Recent advances in cryo-EM have enabled the determination of high-resolution structures of membrane protein complexes like Na+-NQR, capturing different conformational states during the catalytic cycle .

  • X-ray crystallography: This technique provides atomic-level resolution of protein structures, complementing the dynamic information from cryo-EM and SAXS .

  • Site-directed mutagenesis: Systematic mutation of conserved residues in subunit E, particularly those involved in the [2Fe-2S] cluster formation, can provide insights into their roles in electron transfer and ion translocation.

  • Activity assays: Measuring Na+-dependent quinone reductase activity and Na+-independent NADH dehydrogenase activity with soluble quinones allows assessment of the functional impact of mutations or structural changes .

What expression systems and conditions optimize the production of functional recombinant Na+-NQR subunit E?

Based on successful approaches with similar proteins, the following strategies are recommended for optimizing the expression of functional recombinant Na+-NQR subunit E:

Expression System Selection:

  • BL21 pLysS has been successfully used as an expression host for Yersinia proteins .

  • IPTG-inducible expression vectors like pWS provide good control over protein production .

  • Consider co-expression of all six nqr genes (nqrA-F) along with maturation factors apbE and nqrM to obtain a functional complex .

Optimization of Expression Conditions:

  • Lower temperatures (27°C instead of 37°C) often improve protein solubility and proper folding .

  • Induction time of 5 hours has been effective for Yersinia protein expression .

  • Inducer concentration should be optimized to balance protein yield with proper folding.

Buffer and Media Composition:

  • Rich media formulations typically provide better yields for membrane proteins.

  • Addition of specific cofactors or metals (particularly iron sources) may improve the incorporation of the [2Fe-2S] cluster.

What purification strategies are most effective for isolating Na+-NQR subunit E while maintaining its native structure?

Effective purification strategies for Na+-NQR subunit E should consider its membrane-associated nature and the need to maintain the integrity of the [2Fe-2S] cluster:

  • Membrane Fraction Isolation: Differential centrifugation to separate membrane fractions containing the Na+-NQR complex.

  • Detergent Solubilization: Careful selection of mild detergents to solubilize the membrane proteins without disrupting protein-protein interactions or cofactor binding.

  • Chromatographic Techniques: A combination of ion exchange and size exclusion chromatography has been effectively used to purify Yersinia proteins to near homogeneity . For example:

    • Anion exchange chromatography using a linear gradient of NaCl for initial separation

    • Size exclusion chromatography for further purification and to confirm the oligomeric state

  • Tag-free Purification: When possible, purification without affinity tags is preferred to avoid interference with protein function. This approach has yielded more than 180 milligrams of purified protein per liter of batch culture for other Yersinia proteins .

  • Buffer Optimization: Maintaining appropriate pH, ionic strength, and possibly including stabilizing agents to preserve the native structure throughout purification.

How can the functional integrity of recombinant Na+-NQR subunit E be verified?

Several complementary approaches can be used to verify the functional integrity of recombinant Na+-NQR subunit E:

What techniques are available for studying the electron transfer and Na+ translocation mechanisms involving Na+-NQR subunit E?

Several specialized techniques can provide insights into the electron transfer and Na+ translocation mechanisms:

  • Rapid Kinetics Methods:

    • Stopped-flow spectroscopy to monitor rapid electron transfer events

    • Pre-steady-state kinetics to identify rate-limiting steps

  • Electrochemical Techniques:

    • Protein film voltammetry to determine redox potentials of cofactors

    • Chronoamperometry to measure electron transfer rates

  • Ion Transport Assays:

    • 22Na+ isotope uptake measurements

    • Membrane potential monitoring using voltage-sensitive dyes

    • Na+ electrode-based assays

  • Advanced Imaging:

    • Single-molecule FRET to detect conformational changes during catalysis

    • Cryo-EM to capture different conformational states in the catalytic cycle

  • Computational Methods:

    • Molecular dynamics simulations to model conformational changes

    • Quantum mechanical calculations to study electron transfer pathways

How does Na+-NQR contribute to the pathophysiology of Yersinia enterocolitica serotype O:8 / biotype 1B?

Yersinia enterocolitica is a significant bacterial pathogen with various virulence traits including biofilm formation and the ability to establish close contact with eukaryotic target cells . The pathophysiology of Yersinia involves tightly regulated gene expression in response to environmental conditions.

Na+-NQR likely contributes to Yersinia pathophysiology through several mechanisms:

  • Energy Generation: By coupling NADH oxidation to Na+ translocation, Na+-NQR provides an alternative energy conservation mechanism that may be particularly important under certain environmental conditions encountered during infection.

  • Adaptation to Environmental Stresses: The Yersinia infectious cycle involves transitions between different environments (e.g., external environment, insect vector, mammalian host), each with distinct physicochemical properties . Na+-NQR may play a role in adaptation to these changing conditions, particularly with respect to pH and ion concentration.

  • Metabolic Flexibility: The ability to use Na+ gradients for energy conservation may provide metabolic flexibility, allowing Yersinia to thrive in various ecological niches and potentially contributing to its pathogenicity.

  • Potential Link to Virulence Systems: There is evidence for interrelationships between central carbon metabolism and virulence systems in pathogenic Yersinia. For instance, regulatory components of the Yersinia enterocolitica type three secretion system (T3SS) have been found to physically interact with metabolic enzymes . Similar connections may exist between Na+-NQR and virulence factors.

How can recombinant Na+-NQR subunit E be utilized in vaccine development against Yersinia enterocolitica?

Recombinant proteins from Yersinia enterocolitica have shown potential for vaccine development. While the search results don't specifically address Na+-NQR subunit E in vaccine contexts, principles from other Yersinia recombinant protein approaches can be applied:

  • Antigen Delivery Systems: Attenuated recombinant Yersinia enterocolitica O8 has been used to deliver antigens via the type three secretion system (T3SS) . Similar approaches could potentially be applied using Na+-NQR subunit E as a carrier or fusion partner for antigenic epitopes.

  • Subunit Vaccine Development: Purified recombinant Na+-NQR subunit E could be evaluated as a potential subunit vaccine component, particularly if it contains conserved epitopes across pathogenic Yersinia strains.

  • Adjuvant Properties: Some bacterial proteins possess intrinsic adjuvant properties. Investigation of whether Na+-NQR subunit E has such properties could inform its potential use in vaccine formulations.

  • DNA Vaccine Approaches: The gene encoding Na+-NQR subunit E could be incorporated into DNA vaccine constructs, allowing for in vivo expression and presentation to the immune system.

What are the promising areas for future research on Na+-NQR subunit E in Yersinia enterocolitica?

Several promising research directions emerge from current knowledge about Na+-NQR in Yersinia enterocolitica:

  • Structural Biology: Determining high-resolution structures of the Yersinia enterocolitica Na+-NQR complex in different conformational states would provide valuable insights into its mechanism of action.

  • Regulatory Networks: Investigation of how expression of Na+-NQR is regulated in response to environmental signals encountered during Yersinia infection cycles .

  • Comparative Genomics: Analysis of Na+-NQR variations across different Yersinia strains and their correlation with pathogenicity or environmental adaptation .

  • Drug Target Potential: Since Na+-NQR is absent in humans and present in many bacterial pathogens, exploring its potential as a target for new antibiotics, particularly against multidrug-resistant strains .

  • System-Level Integration: Using multi-omics approaches to understand the integration of Na+-NQR function with other cellular processes in Yersinia, building on existing databases like Yersiniomics .

  • Metabolic Engineering: Exploiting recombinant Na+-NQR systems for biotechnological applications, such as development of biosensors or bioenergy production.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.