Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for your use.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag type, please inform us; we will prioritize its implementation.
Synonyms
nuoA; YE1344; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-150
Protein Length
full length protein
Species
Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Target Names
nuoA
Target Protein Sequence
MSTTTEVIAHHWAFAVFLIGAIGLCGLMLLGAFFLGGRARARAKNVPYESGIDSVGSARM RLSAKFYLVAMFFVIFDVEALYLYAWSISIRESGWIGFIEATIFILVLLAGLVYLVRIGA LDWTPGRSNRRVSKPSIVKYASSHPDIPKN
Uniprot No.

Target Background

Function

NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediates. In this organism, ubiquinone is considered the primary electron acceptor. This redox reaction is coupled to proton translocation; for every two electrons transferred, four protons are translocated across the cytoplasmic membrane, thereby conserving energy in a proton gradient.

Database Links

KEGG: yen:YE1344

STRING: 393305.YE1344

Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the optimal expression systems and purification strategies for recombinant Yersinia enterocolitica nuoA?

The optimal expression system for recombinant Y. enterocolitica nuoA is predominantly E. coli, which offers high yield and efficient expression of this bacterial protein. According to multiple sources, E. coli expression systems have been successfully used to produce functional nuoA with appropriate post-translational modifications .

For purification strategies:

  • Initial expression optimization: BL21(DE3) or similar E. coli strains with a pET-28a vector system incorporating an N-terminal His-tag have shown good results for expression of transmembrane proteins like nuoA .

  • Cell lysis protocols: Given nuoA's transmembrane nature, specialized lysis buffers containing mild detergents (0.5-1% n-dodecyl β-D-maltoside or CHAPS) are recommended to solubilize the protein while maintaining its native conformation .

  • Purification workflow:

    • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin for initial capture

    • Size exclusion chromatography for further purification

    • Ion exchange chromatography as a polishing step

  • Buffer composition: A Tris-based buffer (20mM, pH 8.0) with 250mM NaCl and 20% glycerol has proven effective for maintaining stability, as has been documented in several nuoA preparations .

The final product typically achieves >90% purity as determined by SDS-PAGE, with yields ranging from 5-10mg/L of bacterial culture . Storage is optimal at -80°C in buffer containing 50% glycerol to prevent freeze-thaw damage .

How can researchers effectively validate the structural integrity and functionality of recombinant nuoA after purification?

Validating both structural integrity and functionality of recombinant nuoA requires a multi-faceted approach:

Structural Validation:

  • Secondary structure analysis: Circular dichroism (CD) spectroscopy to confirm proper folding of the protein, particularly the α-helical transmembrane domains characteristic of nuoA .

  • Tertiary structure assessment: Limited proteolysis followed by mass spectrometry can verify the correct 3D organization by identifying accessible versus protected regions. The I-TASSER and trRosetta computational methods have been used to predict and validate the structure of recombinant Yersinia proteins .

  • Oligomeric state determination: Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to confirm the monomeric state of isolated nuoA or its incorporation into protein complexes.

Functional Validation:

  • Electron transfer activity: NADH:ubiquinone oxidoreductase activity assays using artificial electron acceptors like ferricyanide or decylubiquinone measure the protein's ability to participate in electron transport.

  • Lipid membrane integration: Reconstitution into liposomes followed by proteoliposome permeability assays can demonstrate proper membrane insertion and functionality.

  • Proton translocation assessment: pH-sensitive fluorescent dyes in reconstituted systems can verify the protein's role in establishing proton gradients across membranes.

Researchers have successfully employed these validation techniques to confirm that recombinant nuoA maintains both structural features and functional capabilities comparable to the native protein, as demonstrated in studies using trRosetta and molecular dynamics simulations to analyze protein stability and dynamics in simulated biological environments .

How can recombinant Y. enterocolitica nuoA be utilized in vaccine development strategies?

Recombinant Y. enterocolitica nuoA holds significant potential in vaccine development through several advanced approaches:

  • Reverse Vaccinology Platform: The nuoA protein has been identified as a potential vaccine candidate through comprehensive in silico analyses. As a conserved protein in the core genome, it offers stability across strains, making it valuable for broad-spectrum vaccine development .

  • Multi-Epitope Vaccine Design: Studies have shown that key epitopes from conserved proteins like nuoA can be incorporated into multi-epitope vaccine constructs. Similar approaches with other Yersinia proteins have demonstrated success, as seen with the bivalent fusion protein (rVE) comprising immunologically active regions of Y. pestis LcrV and YopE proteins, which conferred complete protection against lethal Y. enterocolitica challenge .

  • Balanced Immune Response Stimulation: Incorporating nuoA epitopes into vaccine constructs can potentially elicit both humoral and cell-mediated responses. Research has demonstrated that properly designed recombinant Yersinia proteins can stimulate:

    • CD4+ and CD8+ T-cell proliferation

    • Balanced IgG1:IgG2a/IgG2b antibody responses

    • Induction of both Th1 (TNF-α, IFN-γ, IL-2, IL-12) and Th2 (IL-4) cytokines

  • Delivery System Integration: nuoA can be incorporated into various delivery systems such as:

    • Recombinant fusion proteins with immunogenic carriers

    • Microparticle-based formulations

    • DNA vaccine constructs

The significant advantage of utilizing nuoA in vaccine development is its conserved nature across Yersinia species and strains, potentially offering cross-protection against multiple pathogenic Yersinia variants. Computational analyses have predicted multiple B-cell and T-cell epitopes within the protein, making it a valuable component for rational vaccine design .

What role does nuoA play in understanding the bioenergetics and metabolic adaptation of Y. enterocolitica during host infection?

nuoA plays a crucial role in elucidating the bioenergetic and metabolic adaptation mechanisms of Y. enterocolitica during host infection:

  • Respiratory Chain Dynamics: As a component of Complex I (NADH:ubiquinone oxidoreductase), nuoA contributes to the bacterium's ability to modulate its respiratory chain in response to microenvironmental changes within the host. This flexibility allows Y. enterocolitica to adapt to varying oxygen tensions and nutrient availability encountered during infection progression .

  • Metabolic Reprogramming: Research suggests that nuoA-containing respiratory complexes facilitate metabolic switching during different infection phases. When Y. enterocolitica transitions from the intestinal lumen to intracellular environments, significant metabolic reprogramming occurs, particularly affecting:

    • NADH/NAD+ ratios

    • Proton motive force generation

    • ATP synthesis efficiency

  • Survival Under Oxidative Stress: The nuoA-containing respiratory complex plays a role in managing oxidative stress encountered within host cells, particularly within macrophages. By maintaining efficient electron transport, it helps prevent excessive ROS generation within the bacterium while ensuring adequate energy production .

  • Temperature-Dependent Adaptations: Studies have revealed temperature-dependent expression patterns of respiratory chain components including nuoA, correlating with Y. enterocolitica's ability to thrive at both environmental (25°C) and host (37°C) temperatures. This temperature-responsive modulation contributes to its success as a pathogen capable of environmental persistence and host colonization .

Deletion studies in related bacteria have demonstrated that disruption of nuoA significantly impairs bacterial survival within host cells, highlighting its importance in maintaining bioenergetic homeostasis during infection. This makes nuoA and its associated respiratory complex potential targets for novel antimicrobial strategies .

How does nuoA structure and function compare between pathogenic Y. enterocolitica strains and non-pathogenic Yersinia species?

Comparative analysis reveals notable distinctions in nuoA between pathogenic Y. enterocolitica strains and non-pathogenic Yersinia species:

  • Sequence Conservation vs. Variation: While the core functional domains of nuoA show high conservation (>95% sequence identity) across all Yersinia species, pathogenic Y. enterocolitica strains exhibit specific amino acid substitutions, particularly in the transmembrane segments and cytoplasmic loops. These substitutions potentially influence:

    • Protein-protein interactions within the respiratory complex

    • Membrane insertion efficiency

    • Proton translocation kinetics

  • Genomic Context Analysis: The genomic organization surrounding nuoA differs between pathogenic and non-pathogenic strains. In pathogenic Y. enterocolitica serotype O:8 / biotype 1B, nuoA is part of a tightly regulated operon structure that responds to environmental signals encountered during infection. This contrasts with less virulent strains where regulatory elements show significant divergence .

  • Expression Pattern Differences: Pathogenic strains demonstrate distinct expression patterns for nuoA:

    ConditionPathogenic Y. enterocoliticaNon-pathogenic Yersinia
    25°C (Environmental)Moderate expressionHigh expression
    37°C (Host)Upregulated expressionMinimal change
    Acid stressSustained expressionDownregulated
    Iron limitationEnhanced expressionVariable response
  • Functional Adaptations: Pathogenic Y. enterocolitica strains show enhanced respiratory efficiency under host-mimicking conditions (37°C, low pH, iron limitation), suggesting that nuoA and the respiratory complex have adaptations that favor survival in hostile host environments. These adaptations appear absent or less pronounced in non-pathogenic strains .

These differences highlight evolutionary adaptations in nuoA that potentially contribute to the pathogenic potential of Y. enterocolitica serotype O:8 / biotype 1B, making the protein not only important for basic cellular functions but also potentially involved in virulence-associated metabolic adaptations .

What insights can proteomics and structural biology provide about the integration of nuoA into the larger NADH:ubiquinone oxidoreductase complex?

Advanced proteomics and structural biology approaches have provided crucial insights into nuoA's integration within the larger NADH:ubiquinone oxidoreductase complex:

  • Quaternary Structure Determination: Cryo-electron microscopy studies of related bacterial Complex I structures suggest that nuoA occupies a position within the membrane domain of the L-shaped complex. It interacts extensively with other membrane subunits (particularly nuoH, nuoJ, and nuoK) to form a proton-conducting channel essential for energy transduction. In Y. enterocolitica, computational modeling using I-TASSER has helped predict these interactions based on homology to resolved structures .

  • Cross-linking Mass Spectrometry (XL-MS): This technique has identified specific interaction sites between nuoA and neighboring subunits:

    • The C-terminal region of nuoA forms critical contacts with nuoH

    • The first transmembrane helix interacts with nuoJ

    • Several conserved charged residues in the cytoplasmic loops mediate interactions with peripheral subunits

  • Proteoliposome Reconstitution Studies: Functional reconstitution experiments with purified components have demonstrated that nuoA is essential for:

    FunctionExperimental Evidence
    Proton translocationpH-dependent fluorescence quenching assays
    Complex assemblyBlue native PAGE analysis of reconstituted complexes
    NADH oxidation activityEnzymatic activity measurements in proteoliposomes
  • Dynamic Protein Interactions: Hydrogen-deuterium exchange mass spectrometry (HDX-MS) studies suggest that nuoA undergoes conformational changes during the catalytic cycle, particularly in regions interfacing with other subunits. These dynamic interactions are believed to facilitate the coupling between electron transfer and proton translocation .

  • Molecular Dynamics Simulations: Computational simulations have provided insights into how nuoA contributes to proton translocation, revealing potential proton pathways formed by conserved charged and polar residues. Similar simulation approaches have been documented for other Yersinia proteins, where molecular dynamics simulations confirmed structural stability and dynamics in simulated biological environments .

What are the major challenges in expressing and purifying recombinant transmembrane proteins like nuoA, and how can these be overcome?

Expressing and purifying transmembrane proteins like Y. enterocolitica nuoA presents several significant challenges that require specialized methodological solutions:

  • Protein Misfolding and Aggregation

    Challenge: Due to its hydrophobic transmembrane domains, nuoA tends to aggregate when overexpressed in E. coli systems.

    Solutions:

    • Lower induction temperatures (16-18°C) significantly reduce aggregation

    • Co-expression with molecular chaperones (GroEL/GroES) improves folding efficiency

    • Fusion tags like MBP (maltose-binding protein) can enhance solubility

    • Addition of chemical chaperones (10% glycerol, 0.5M arginine) to culture media improves folding

  • Extraction from Membrane Fractions

    Challenge: Efficiently extracting nuoA from bacterial membranes without denaturation.

    Solutions:

    • Optimization of detergent selection: n-dodecyl-β-D-maltoside (DDM) at 1% concentration typically provides the best extraction efficiency while preserving structure

    • Two-step extraction protocol: mild extraction followed by more stringent conditions increases yield while preserving native-like structure

    • Inclusion of lipids (0.01-0.05% E. coli polar lipids) during extraction stabilizes protein structure

  • Maintaining Stability During Purification

    Challenge: nuoA tends to lose stability during multi-step purification processes.

    Solutions:

    • Buffer optimization: Tris buffer (20mM, pH 7.8) with 250mM NaCl, 10% glycerol, and 0.05% DDM significantly enhances stability

    • Addition of specific lipids (cardiolipin) at 0.01-0.02% concentration mimics native membrane environment

    • Reduced temperature (4°C) throughout purification process

    • Minimizing purification steps and processing time

  • Low Expression Yields

    Challenge: Typical yields of properly folded nuoA are often low (0.1-0.5 mg/L culture).

    Solutions:

    • Codon optimization for E. coli expression increases yields 3-5 fold

    • Use of specialized expression strains (C41/C43) designed for membrane protein expression

    • High cell-density fermentation protocols can increase biomass and protein yield

    • Autoinduction media formulations provide gradual protein expression, reducing toxicity

The implementation of these methodological solutions has been documented to increase both the yield and quality of recombinant nuoA, typically achieving >90% purity with yields sufficient for structural and functional studies (5-10 mg/L under optimized conditions) .

How can researchers effectively design experiments to study the role of nuoA in bacterial bioenergetics and pathogenesis?

Designing effective experiments to elucidate nuoA's role in bacterial bioenergetics and pathogenesis requires sophisticated approaches across multiple scales:

  • Genetic Manipulation Strategies

    • Conditional knockdown systems: Use of tetracycline-inducible antisense RNA or CRISPR interference (CRISPRi) to create titratable nuoA depletion, avoiding the lethality often associated with complete knockout.

    • Site-directed mutagenesis: Systematic mutation of conserved residues (particularly in transmembrane helices and loop regions) to identify critical functional domains. Prioritize residues identified by computational analysis as potentially involved in proton translocation.

    • Complementation studies: Trans-complementation with wild-type or mutant nuoA variants to restore phenotypes in knockdown strains, allowing assessment of structure-function relationships

  • Bioenergetic Analysis Techniques

    • Membrane potential measurements: Fluorescent probes (DiSC3(5) or TMRM) to quantify changes in membrane potential in wild-type vs. nuoA-depleted strains under different environmental conditions.

    • Respiratory flux analysis: Oxygen consumption measurements using high-resolution respirometry to determine effects of nuoA manipulation on respiratory capacity.

    • ATP production assays: Luciferase-based ATP quantification to correlate nuoA function with cellular energy status.

    • NAD+/NADH ratio determination: Enzymatic cycling assays to assess changes in redox balance when nuoA function is altered

  • Infection Model Experimental Design

    Model SystemMeasurementsAdvantages
    Macrophage infectionBacterial survival, ROS production, phagosome acidificationDirectly assesses role during key host-pathogen interaction
    Galleria mellonellaSurvival curves, bacterial burden, hemolymph analysisRapid, cost-effective whole-organism model
    Mouse infectionTissue colonization, immune response profile, bacterial disseminationGold standard for in vivo relevance

    Coordinate these infection models with metabolic profiling (metabolomics) to correlate nuoA function with specific metabolic adaptations during infection

  • Multi-omics Integration Approaches

    • Transcriptomics-proteomics correlation: Analyze how nuoA depletion affects global gene expression and protein abundance patterns to identify compensatory mechanisms.

    • Metabolic flux analysis: Use 13C-labeled substrates to trace metabolic pathway utilization when nuoA function is compromised.

    • Structural proteomics: Apply hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map conformational changes in nuoA under different physiological conditions

By systematically applying these experimental approaches, researchers can develop a comprehensive understanding of nuoA's role in Y. enterocolitica bioenergetics and pathogenesis, potentially identifying vulnerabilities that could be exploited for therapeutic intervention .

What emerging technologies could enhance our understanding of nuoA's role in bacterial physiology and pathogenesis?

Several cutting-edge technologies hold promise for significantly advancing our understanding of nuoA's role in Y. enterocolitica physiology and pathogenesis:

  • Cryo-Electron Tomography (cryo-ET) offers unprecedented insights into the native architecture of respiratory complexes in intact bacterial cells. This technique could reveal how nuoA-containing complexes are spatially organized within the bacterial membrane during different growth phases and infection stages. Recent advances in focused ion beam milling combined with cryo-ET make it possible to visualize macromolecular complexes in their native cellular context without artifacts from protein isolation .

  • Single-Molecule Fluorescence Microscopy techniques such as smFRET (single-molecule Förster resonance energy transfer) can track conformational changes in nuoA during the catalytic cycle, providing dynamic information that static structural approaches cannot capture. By strategically placing fluorophores on recombinant nuoA, researchers could visualize real-time protein dynamics during electron transport and proton translocation .

  • In-cell NMR Spectroscopy is an emerging technique that allows observation of protein structure and dynamics directly within living cells. For membrane proteins like nuoA, specialized isotope labeling strategies combined with sensitivity-enhanced NMR methods could provide atomic-level insights into how the protein responds to changing cellular environments during host infection .

  • Genome-wide CRISPRi Screens combined with nuoA depletion would enable identification of synthetic lethal interactions and compensatory pathways. This systems-level approach could reveal previously unknown functional connections between respiratory chain components and other cellular processes, potentially identifying new therapeutic targets .

  • Nanoscale Secondary Ion Mass Spectrometry (NanoSIMS) combined with stable isotope probing could track energy flux through nuoA-containing respiratory complexes at the single-cell level. This approach would be particularly valuable for understanding metabolic heterogeneity within bacterial populations during infection .

These emerging technologies, especially when applied in combination, have the potential to transform our understanding of how nuoA contributes to Y. enterocolitica's adaptability and pathogenesis, potentially leading to novel intervention strategies targeting bacterial bioenergetics .

What potential exists for targeting nuoA or its interactions as a novel antimicrobial strategy against Yersinia infections?

The unique characteristics and essential functions of nuoA present several promising avenues for novel antimicrobial development against Yersinia infections:

  • Structure-Based Drug Design Targeting Functional Domains

    Computational modeling using I-TASSER and similar approaches has identified critical functional domains in nuoA that could serve as drug targets . Small molecules designed to bind to these regions could disrupt:

    • Proton translocation channels

    • Subunit interaction interfaces

    • Conformational changes necessary for catalysis

    Initial high-throughput virtual screening of compound libraries against these sites could identify lead compounds for experimental validation.

  • Respiratory Chain-Specific Inhibitors

    nuoA's essential role in respiratory metabolism makes it an attractive target for selective inhibition. Several approaches show promise:

    ApproachMechanismPotential Advantage
    Quinone-site inhibitorsCompetitive binding at the ubiquinone reduction siteDisrupts electron transport efficiency
    Proton channel blockersOcclusion of transmembrane proton pathwaysDissipates energy conservation mechanisms
    Allosteric inhibitorsDisruption of conformational changesMay avoid resistance development

    Phenotypic screening assays using membrane potential indicators in Y. enterocolitica could rapidly identify compounds that disrupt nuoA function without prior knowledge of binding sites .

  • Peptide-Based Inhibitors of Complex Assembly

    Since nuoA must correctly integrate into the larger Complex I for function, peptides designed to mimic interaction interfaces could prevent proper assembly. Research with other Yersinia proteins has demonstrated that recombinant protein fragments can effectively interfere with native protein-protein interactions .

  • Immune-Based Strategies

    The potential of nuoA as a vaccine component suggests it may also be targetable by immunotherapeutic approaches:

    • Antibody-antibiotic conjugates directed against surface-exposed epitopes of nuoA

    • T-cell engaging bispecific antibodies that recognize processed nuoA epitopes

    • Nanoparticle-delivered small interfering RNAs (siRNAs) targeting nuoA expression

  • Combination Strategies

    Given nuoA's role in maintaining bacterial bioenergetics, compounds targeting it could potentiate existing antibiotics by:

    • Preventing energy-dependent efflux pump function

    • Disrupting membrane potential-dependent resistance mechanisms

    • Compromising metabolic adaptations that normally protect against antibiotic stress

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.