Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B NADH-quinone oxidoreductase subunit K (nuoK)
Shipped with Ice Packs 
In Stock 
Description
Definition and Overview of Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B NADH-Quinone Oxidoreductase Subunit K (nuoK)
Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B NADH-quinone oxidoreductase subunit K (nuoK) is a engineered protein produced through heterologous expression in E. coli. This subunit is part of the NADH-quinone oxidoreductase complex (NDH-1), a multi-subunit enzyme critical for bacterial electron transport and proton translocation . The recombinant form includes an N-terminal His-tag for affinity chromatography purification and is truncated to amino acids 1–100 (UniProt ID: A1JLI8) .
Diagnostic and Immunological Tools
Recombinant nuoK is used in ELISA kits to detect specific antibodies or antigens, aiding in serological studies of Y. enterocolitica infections .
Related Subunits in NDH-1 Complex
| Subunit | UniProt ID | Function | Recombinant Availability |
|---|---|---|---|
| nuoA | A1JLG6 | Subunit of NADH-binding domain | Partial (cell-free expression) |
| nuoB | A1JLJ5 | Core subunit involved in quinone binding | Full-length |
| nuoC | A1JLG6 | Membrane-anchored subunit | Partial |
| nuoH | A1JLJ8 | ATP synthase subunit | Partial |
| nuoI | A1JLJ9 | Membrane-anchored subunit | Partial |
These subunits are commercially available for structural, functional, or immunological studies .
Product Specs
Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we understand your specific requirements. Should you have a preference, please indicate it when placing your order, and we will fulfill your request.
Note: While we will prioritize shipping the format currently in stock, we understand your specific requirements. Should you have a preference, please indicate it when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery estimates, please contact your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges may apply.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges may apply.
Notes
Repeated freezing and thawing is discouraged. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend incorporating 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms maintain their stability for 12 months at -20°C/-80°C.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms maintain their stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
While the tag type is determined during production, we are open to your specific requests. If you have a preferred tag type, please communicate it to us, and we will prioritize your request.
Synonyms
nuoK; YE1353; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Target Names
nuoK
Target Protein Sequence
MIPLQHGLILAAILFVLGLTGLIIRRNLLFMLISLEVMINAAALAFVVAGSYWGQADGQV
MYILAITLAAAEASIGLALLLQLYRRRHTLNIDTVSEMRG
Uniprot No.
Target Background
Function
NDH-1 functions as an electron shuttle, transferring electrons from NADH, through FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this particular species, the immediate electron acceptor for the enzyme is believed to be ubiquinone. The enzyme couples the redox reaction with proton translocation, transferring four hydrogen ions across the cytoplasmic membrane for every two electrons transferred. This process effectively conserves the redox energy within a proton gradient.
Database Links
KEGG: yen:YE1353
STRING: 393305.YE1353
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
