Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)

What is the AaeA efflux pump subunit and what is its role in Yersinia enterocolitica?

The AaeA protein functions as a membrane fusion protein subunit of the p-hydroxybenzoic acid efflux pump system in Yersinia enterocolitica serotype O:8 / biotype 1B. This protein forms part of a multicomponent efflux system that enables the bacterium to export aromatic carboxylic acids, particularly p-hydroxybenzoic acid (pHBA), out of the cell. The full-length protein consists of 311 amino acids and plays a critical role in the assembly and function of the complete efflux machinery .

Based on homology studies with Escherichia coli, the AaeA subunit likely works in conjunction with AaeB (the inner membrane transporter component) to form a functional efflux system. In E. coli, this system serves as a "metabolic relief valve" to alleviate toxic effects of imbalanced metabolism, particularly the accumulation of aromatic carboxylic acids . The system in Y. enterocolitica likely serves a similar purpose, contributing to bacterial survival under certain metabolic conditions.

How is the AaeA efflux pump regulated in Yersinia enterocolitica?

The regulation of the AaeA efflux pump in Y. enterocolitica appears to follow similar patterns to its E. coli homolog. In E. coli, the expression of aaeA is regulated by the LysR-type transcriptional regulator AaeR (formerly YhcS). This regulatory protein responds to the presence of aromatic carboxylic acids, particularly pHBA, which act as inducers of aaeRXAB expression .

The regulatory mechanism involves:

• Detection of inducer compounds (aromatic carboxylic acids) by the AaeR regulator

• Binding of AaeR to the promoter region of the aae operon

• Activation of transcription of the aaeXAB genes

• Production and assembly of the functional efflux pump system

When Y. enterocolitica is exposed to pHBA or other aromatic carboxylic acids, the expression of aaeA is likely upregulated through this regulatory pathway, allowing the bacterium to respond to and eliminate these potentially harmful compounds.

What is the relationship between AaeA and virulence in Yersinia enterocolitica?

While the direct relationship between AaeA and virulence hasn't been fully characterized, understanding this relationship requires context about Y. enterocolitica virulence mechanisms. Y. enterocolitica serotype O:8 / biotype 1B is among the most virulent biotypes, possessing both a virulence plasmid (pYV/pCD) and chromosomal virulence genes .

The virulence of Y. enterocolitica biotype 1B is attributed primarily to:

• The 70-kb virulence plasmid (pYV/pCD) encoding factors like YadA and the Ysc-Yop type III secretion system

• Chromosomal virulence genes including inv, ail, yst, myf, and high-pathogenicity island (HPI)

• Factors that enhance survival under host conditions, including resistance to phagocytosis and complement-mediated lysis

What experimental approaches are optimal for studying AaeA function in Yersinia enterocolitica?

To effectively study AaeA function in Y. enterocolitica, researchers should consider multiple complementary experimental approaches:

A. Gene expression analysis:

• qRT-PCR to measure aaeA expression under various conditions

• Transcriptomics (RNA-seq) to identify co-regulated genes

• Reporter gene fusions (lacZ, gfp) to monitor promoter activity

B. Mutational analysis:

• Construction of aaeA deletion mutants

• Complementation studies with recombinant AaeA

• Site-directed mutagenesis of key functional residues

C. Functional assays:

• Susceptibility testing to aromatic carboxylic acids

• Efflux assays using radiolabeled or fluorescent substrates

• Growth curve analysis under various stress conditions

D. Protein characterization:

• Expression and purification of recombinant AaeA (available as His-tagged construct)

• Structural studies (X-ray crystallography, cryo-EM)

• Protein-protein interaction studies (pull-down assays, bacterial two-hybrid)

For optimal results, researchers should combine these approaches to build a comprehensive understanding of AaeA function. For instance, the full-length recombinant protein (amino acids 1-311) with an N-terminal His-tag expressed in E. coli provides an excellent resource for in vitro studies .

How does the substrate specificity of the AaeA-containing efflux system compare between Yersinia enterocolitica and Escherichia coli?

The substrate specificity of efflux systems can provide insights into their physiological roles and potential exploitation for antimicrobial development. Based on studies in E. coli, the AaeAB efflux system has a narrow substrate specificity, primarily transporting aromatic carboxylic acids .

In E. coli, the characterized substrates include:

The E. coli AaeAB system showed high specificity, as "only a few aromatic carboxylic acids of hundreds of diverse compounds tested were defined as substrates" . This suggests a specialized role rather than a general multidrug resistance mechanism.

To determine the substrate specificity of the Y. enterocolitica AaeA-containing efflux system, researchers should:

• Generate aaeA knockout mutants in Y. enterocolitica

• Test susceptibility to various aromatic compounds

• Perform direct efflux assays with potential substrates

• Analyze expression induction patterns in response to different compounds

What is the potential role of AaeA in antibiotic resistance of Yersinia enterocolitica?

While the AaeA-containing efflux system primarily exports aromatic carboxylic acids, its potential contribution to antibiotic resistance merits investigation, particularly for antibiotics with aromatic carboxylic acid moieties.

Based on studies of related efflux systems, several methodological approaches can assess AaeA's role in antibiotic resistance:

• Susceptibility testing: Compare minimum inhibitory concentrations (MICs) of various antibiotics against wild-type and aaeA-deleted strains of Y. enterocolitica

• Gene expression analysis: Measure aaeA expression levels in response to subinhibitory concentrations of antibiotics

• Direct efflux assays: Use fluorescent or radiolabeled antibiotics to measure efflux activity in wild-type versus mutant strains

• Synergy testing: Evaluate the effects of efflux pump inhibitors on antibiotic susceptibility

• Clinical isolate analysis: Compare aaeA expression levels between antibiotic-susceptible and resistant clinical isolates

Understanding the potential role of AaeA in antibiotic resistance could provide insights into resistance mechanisms and potential targets for efflux pump inhibitors as adjuvants to antibiotic therapy.

How can recombinant AaeA be effectively used for structural and functional studies?

Recombinant AaeA protein provides a valuable tool for in-depth structural and functional characterization. The commercially available recombinant full-length Yersinia enterocolitica serotype O:8 / biotype 1B p-hydroxybenzoic acid efflux pump subunit AaeA (amino acids 1-311) with an N-terminal His-tag expressed in E. coli can be utilized in multiple research applications:

Structural studies:

• X-ray crystallography to determine the three-dimensional structure

• Circular dichroism spectroscopy to analyze secondary structure content

• NMR spectroscopy for dynamic structural information

• Cryo-electron microscopy for visualization of the assembled efflux complex

Functional analyses:

• In vitro reconstitution in liposomes to study transport properties

• Surface plasmon resonance to measure interactions with partner proteins

• Isothermal titration calorimetry to determine binding constants with substrates

• Site-directed mutagenesis of conserved residues followed by functional assays

The amino acid sequence of the full-length protein (MSTFSLKIIRIGITLLVVLLAVIAIFKVWAFYTESPWTRDAKFTADVVAIAPDVSGLITDVPVKDNQLVQKGQILFVIDQPRYQQALAEAEADVAYYQTLAAEKQRESGRRQRLGIQAMSQEEIDQSNNVLQTVRHQLAKAVAVRDLAKLDLERTTVRAPAEGWVTNLNVHAGEFINRGATAVALVKKDTFYILAYLEETKLEGVKPGHRAEITPLGSNRILHGTVDSISAGVT) can be analyzed for functional domains, transmembrane regions, and conserved motifs to guide experimental design.

What animal models are most appropriate for studying the in vivo role of AaeA in Yersinia enterocolitica infection?

Selection of appropriate animal models is critical for understanding the in vivo significance of bacterial factors. For Y. enterocolitica, several animal models have been established, with the pig model being particularly relevant:

Pig model:
The pig model is especially suitable as pigs are a natural reservoir for Y. enterocolitica, and experimental pig yersiniosis has been well-characterized. Studies have shown that Y. enterocolitica serotype O:8 wild-type strain and its derivatives can persist in the lymphoid tissue of tonsils and small intestines, causing asymptomatic infection . This model allows assessment of:

• Bacterial colonization and persistence

• Host immune responses

• Pathological changes in relevant tissues

• Bacterial gene expression in vivo

To study AaeA specifically, researchers could:

• Create aaeA deletion or overexpression strains of Y. enterocolitica

• Infect pigs orally with wild-type and modified strains

• Monitor colonization, persistence, and host responses

• Collect tissues for histopathology and bacterial gene expression analysis

• Measure immune responses specific to the infection

The pig model would provide physiologically relevant insights into the role of AaeA during natural infection, as demonstrated by previous studies with LPS mutants of Y. enterocolitica serotype O:8 .

How does the AaeA efflux system interact with host-derived antimicrobial compounds during infection?

During infection, Y. enterocolitica encounters various host-derived antimicrobial compounds, including bile acids, fatty acids, and antimicrobial peptides. The potential role of the AaeA efflux system in countering these defenses represents an important research question.

Methodological approaches to study these interactions include:

• Ex vivo survival assays:

  • Exposure of wild-type and aaeA mutant strains to host-derived antimicrobials

  • Survival assays in serum, bile, or intestinal contents

  • Gene expression analysis following exposure to host factors

• Cell culture infection models:

  • Infection of epithelial cells or macrophages with wild-type and aaeA mutant strains

  • Assessment of intracellular survival and replication

  • Analysis of bacterial transcriptional responses within host cells

• In vivo transcriptomics:

  • Recovery of bacteria from infected tissues

  • RNA-seq analysis to measure aaeA expression during different infection stages

  • Comparison of gene expression profiles between wild-type and mutant strains

• Biochemical interaction studies:

  • Testing direct interactions between purified AaeA and host antimicrobial compounds

  • Competition assays with known substrates and host-derived molecules

  • Structural studies of AaeA-substrate complexes

Understanding these interactions could reveal new aspects of bacterial adaptation to host environments and potential targets for therapeutic intervention.

What are the optimal conditions for expressing and purifying functional recombinant AaeA protein?

Successful expression and purification of functional membrane-associated proteins like AaeA require specific considerations:

Expression system optimization:
For recombinant production of AaeA, E. coli has been successfully used as an expression host . Key considerations include:

• Strain selection: BL21(DE3), C41(DE3), or C43(DE3) strains often yield better results for membrane-associated proteins

• Vector choice: pET vectors with T7 promoter systems offer controllable expression

• Fusion tags: N-terminal His-tag has been successfully used for AaeA ; alternative tags include MBP or SUMO for enhanced solubility

• Expression conditions:

  • Temperature: Lower temperatures (16-25°C) often improve proper folding

  • Induction: IPTG concentration of 0.1-0.5 mM is typically used

  • Duration: Extended expression (overnight) at lower temperatures

Purification strategy:
For His-tagged AaeA, a purification workflow might include:

• Cell lysis under native conditions (avoiding harsh detergents)

• Membrane fraction isolation by ultracentrifugation

• Solubilization with mild detergents (DDM, LDAO, or Triton X-100)

• Immobilized metal affinity chromatography (IMAC)

• Size exclusion chromatography for final purification

Quality assessment:

• SDS-PAGE and Western blotting to confirm identity and purity

• Circular dichroism to assess proper folding

• Dynamic light scattering to evaluate homogeneity

• Functional assays to confirm activity

Following these guidelines should yield functional protein suitable for structural and biochemical studies.

What methodologies are most effective for analyzing AaeA-mediated efflux activity in Yersinia enterocolitica?

Multiple complementary approaches can be employed to characterize AaeA-mediated efflux:

Direct measurement of substrate transport:

• Fluorescent substrate assays: Use fluorescent compounds that are potential substrates and measure their accumulation/efflux

• Radiolabeled substrate assays: Use 14C or 3H-labeled aromatic carboxylic acids to track transport

• HPLC-based assays: Measure substrate concentrations inside cells and in the extracellular medium

Indirect assessment of efflux function:

• Growth inhibition assays: Compare growth of wild-type and aaeA mutants in the presence of toxic substrates

• Minimum inhibitory concentration (MIC) determination: Measure susceptibility to potential substrates

• Efflux inhibitor studies: Assess the effect of general efflux inhibitors on susceptibility

Gene expression analysis:

• Reporter gene fusions: Create transcriptional fusions between the aaeA promoter and reporter genes

• qRT-PCR: Measure aaeA expression in response to potential substrates

• RNA-seq: Analyze global transcriptional changes in response to substrates or upon aaeA deletion

A comprehensive approach combining these methods would provide robust evidence for AaeA-mediated efflux activity and its substrate specificity in Y. enterocolitica.

How might AaeA be exploited as a target for novel antimicrobial strategies against Yersinia enterocolitica?

While AaeA may not be essential for viability, targeting efflux systems represents a promising strategy for combating bacterial infections, particularly in combination with existing antibiotics. Several research directions could explore AaeA as an antimicrobial target:

Efflux pump inhibitor (EPI) development:

• High-throughput screening of compound libraries for AaeA inhibitors

• Structure-based design of inhibitors based on AaeA crystal structure

• Evaluation of natural products with known efflux inhibitory properties

• Testing synergy between EPIs and conventional antibiotics

Immunological targeting:

• Evaluation of AaeA as a potential vaccine antigen

• Development of antibodies that neutralize AaeA function

• Assessment of immune responses to AaeA during natural infection

Genetic approaches:

• Antisense RNA or CRISPR interference to downregulate aaeA expression

• Design of antimicrobial peptides that specifically disrupt AaeA function

• Exploration of the potential for phage therapy targeting AaeA-dependent processes

Each approach would require rigorous validation in both in vitro systems and animal models before clinical translation.

What computational approaches can enhance our understanding of AaeA structure and function?

Computational methods offer powerful complementary approaches to experimental studies:

Structural bioinformatics:

• Homology modeling: Using structures of related proteins as templates

• Molecular dynamics simulations: To study protein flexibility and conformational changes

• Docking studies: To predict substrate binding sites and interactions

• Coevolution analysis: To identify functionally coupled residues

Comparative genomics:

• Phylogenetic analysis: To trace the evolution of AaeA across bacterial species

• Synteny analysis: To identify conserved gene neighborhoods

• Selection pressure analysis: To identify residues under positive selection

Systems biology approaches:

• Protein-protein interaction network analysis: To identify functional partners

• Metabolic modeling: To predict the impact of AaeA on bacterial metabolism

• Transcriptional regulatory network analysis: To understand AaeA regulation in context

These computational approaches can generate testable hypotheses and guide experimental design, potentially accelerating research progress and identifying novel aspects of AaeA biology.