Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE (arnE)

Shipped with Ice Packs
In Stock

Description

Microbiological Profile and Classification

Yersinia enterocolitica is a Gram-negative short-form bacillus belonging to the family Enterobacteriaceae, recognized as an important human pathogen capable of causing various gastrointestinal diseases . The species exhibits significant diversity, with multiple serotypes and biotypes demonstrating varying degrees of pathogenicity. Specifically, serotype O:8 falls within the classification system established by Wauters and is considered to possess conspicuous pathogenicity in humans . This serotype is particularly noteworthy as it represents one of the most virulent variants of Y. enterocolitica.

The biotype classification of Y. enterocolitica provides additional insights into its pathogenic potential. According to established biochemical characterization, biotype 1B is associated with enhanced virulence compared to other biotypes . The relationship between serotype O:8 and biotype 1B is particularly significant, as this combination typically demonstrates high pathogenicity in human infections.

Genomic Features and Virulence Determinants

The complete genome sequence of Y. enterocolitica has revealed important insights into its virulence mechanisms and adaptive capabilities. The bacterium possesses a complex genome with multiple pathogenicity islands and mobile genetic elements that contribute to its virulence . Of particular interest is the YAPI (Yersinia adhesion pathogenicity island), which contains genes encoding various virulence factors, including type IV pilus operons shown to be important for bacterial adherence and colonization .

Y. enterocolitica's pathogenicity is further enhanced by its sophisticated Type III Secretion System (TTSS), which enables the translocation of bacterial effector proteins into host cells . This system effectively neutralizes eukaryotic defenses by injecting virulence factors directly into target cells, thereby preventing phagocytosis and other host immune responses . The TTSS represents a critical virulence mechanism that facilitates the establishment and progression of Y. enterocolitica infections.

Biochemical Function as a Flippase Subunit

As a flippase subunit, ArnE plays a crucial role in the translocation of amphipathic molecules across the phospholipid bilayer of the bacterial membrane . Specifically, it facilitates the movement of 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol from the cytoplasmic side to the periplasmic side of the inner membrane. This translocation is essential for the subsequent transfer of the 4-amino-4-deoxy-L-arabinose moiety to lipid A, a component of LPS.

The flippase function requires coordinated action with other membrane proteins and energy input, typically in the form of ATP hydrolysis. This energy-dependent process enables the conformational changes necessary for substrate recognition, binding, and translocation across the hydrophobic membrane environment .

Role in Lipopolysaccharide Modification

The modification of LPS through the addition of 4-amino-4-deoxy-L-arabinose to lipid A represents a critical adaptation mechanism in many Gram-negative bacteria. This modification alters the charge characteristics of the bacterial outer membrane, reducing its negative charge and thereby decreasing the electrostatic attraction for cationic antimicrobial peptides and certain antibiotics.

By facilitating this modification process, ArnE contributes significantly to the bacterium's ability to resist host defense mechanisms and antimicrobial compounds. This resistance mechanism is particularly important during infection, where the bacterium encounters various host antimicrobial peptides as part of the innate immune response.

Contribution to Antimicrobial Resistance

The modification of LPS facilitated by ArnE represents a significant mechanism of antimicrobial resistance in Y. enterocolitica. By altering the surface charge of the bacterial membrane, this modification reduces the binding affinity of cationic antimicrobial peptides, which typically exert their bactericidal effects by disrupting membrane integrity. This resistance mechanism is particularly relevant in the context of the host-pathogen interaction, where antimicrobial peptides constitute an important component of the innate immune response.

Interestingly, research on Y. enterocolitica has identified multiple arsenic-resistance operons, including one located within the YAPI island and another outside of the plasticity zone . While not directly related to ArnE, these arsenic-resistance mechanisms reflect the bacterium's adaptive capabilities and suggest a complex interplay between different resistance mechanisms that collectively enhance bacterial survival in hostile environments.

Role in Host-Pathogen Interactions

The interaction between Y. enterocolitica and host cells involves various virulence factors, including the Type III Secretion System (TTSS) and its effector proteins . While the direct interaction between ArnE and host cells has not been extensively characterized, its role in LPS modification likely contributes to the bacterium's ability to evade host immune responses.

Research has shown that antibodies against certain Y. enterocolitica proteins, such as the V antigen, can mediate protection against infection by promoting bacterial uptake by macrophages . This finding highlights the importance of bacterial surface components in host-pathogen interactions and suggests potential applications in vaccine development.

Cloning and Expression Strategies

The expression of recombinant ArnE involves several molecular biological techniques, including gene amplification, cloning, and protein expression systems. While specific protocols for ArnE expression are not detailed in the available research, similar approaches have been used for other Y. enterocolitica proteins .

Typical cloning strategies involve the amplification of the target gene using polymerase chain reaction (PCR) with specific primers designed based on the genomic sequence. The amplified gene is then inserted into an appropriate expression vector, followed by transformation into a suitable host organism, such as Escherichia coli . The recombinant protein can then be expressed under controlled conditions and purified for further characterization.

Table 1: Common Expression Systems for Recombinant Bacterial Membrane Proteins

Expression SystemHost OrganismVector TypeInduction MethodAdvantagesLimitations
pET SystemE. coli BL21(DE3)T7 promoter-basedIPTGHigh expression levelsPotential inclusion body formation
pBAD SystemE. coli TOP10Arabinose promoterL-arabinoseTight regulationModerate expression levels
pGEX SystemE. colitac promoterIPTGFusion with GST tagLarger fusion protein
pMAL SystemE. colitac promoterIPTGFusion with MBPEnhanced solubility
Cell-free SystemN/AVariousN/AAvoids toxicity issuesLower yield, higher cost

Functional Characterization Methods

The functional characterization of recombinant ArnE requires specialized assays to assess its flippase activity and substrate specificity. These may include reconstitution of the protein in artificial membrane systems, such as liposomes, followed by assays to measure the translocation of fluorescently labeled substrates.

Additionally, the interaction of ArnE with other components of the LPS modification machinery can be studied using techniques such as co-immunoprecipitation, crosslinking, and protein-protein interaction assays. These approaches provide insights into the molecular mechanisms underlying ArnE's function in the context of the larger LPS modification pathway.

Homologs in Other Bacterial Species

ArnE belongs to a family of membrane proteins found across various bacterial species, particularly Gram-negative bacteria. Comparative genomic analyses reveal homologs with similar functions in species such as Escherichia coli and Salmonella enterica, reflecting the conservation of LPS modification pathways among enteric bacteria.

Table 2: Comparative Analysis of ArnE Homologs in Different Bacterial Species

Bacterial SpeciesProtein NameFunctionSequence Similarity (%)Associated Pathogenicity
Y. enterocolitica O:8ArnE4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase100Gastrointestinal infections
E. coliArnE4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase~75*Urinary tract infections, sepsis
S. entericaArnE4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase~70*Gastroenteritis, typhoid fever
P. aeruginosaArnE4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase~60*Respiratory infections, burn infections
K. pneumoniaeArnE4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase~65*Pneumonia, urinary tract infections

*Estimated values based on typical sequence conservation patterns; actual values may vary.

Functional Similarities with Other Membrane Transporters

ArnE shares functional similarities with other membrane transporters involved in the translocation of lipid-linked substrates. These include flippases involved in peptidoglycan biosynthesis, such as MurJ, which translocates lipid II across the cytoplasmic membrane . Despite differences in substrate specificity, these proteins likely share similar structural features and mechanistic principles.

The comparison with other membrane transporters provides insights into the evolutionary relationships between different transport systems and highlights the specialized adaptations that enable ArnE to function in the context of LPS modification and antimicrobial resistance.

Potential as a Diagnostic Marker

The specificity of ArnE to certain serotypes and biotypes of Y. enterocolitica suggests its potential application as a diagnostic marker. Antibodies against ArnE could be developed for use in serological assays, complementing existing diagnostic approaches based on immune sera for identifying pathogenic serotypes of Y. enterocolitica .

Current diagnostic methods for Y. enterocolitica rely on immune sera specific to different serogroups, including O8, which are used in slide agglutination tests . The development of recombinant ArnE-based diagnostic tools could potentially enhance the specificity and reliability of these tests, particularly for the identification of highly pathogenic serotype O:8 / biotype 1B strains.

Therapeutic and Vaccine Development Potential

The role of ArnE in antimicrobial resistance suggests its potential as a target for therapeutic interventions. Inhibitors of ArnE function could potentially enhance the susceptibility of Y. enterocolitica to host antimicrobial peptides and certain antibiotics, providing a novel approach to combat infections caused by this pathogen.

Additionally, recombinant ArnE could be explored as a component of subunit vaccines against Y. enterocolitica. Research has shown that antibodies against certain Y. enterocolitica proteins can mediate protection against infection by promoting bacterial uptake by phagocytic cells . Similarly, immune responses directed against ArnE might interfere with the bacterium's ability to modify its LPS, thereby reducing its resistance to host defense mechanisms.

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format we currently have in stock. However, if you have a specific format preference, please indicate your requirement in the order notes and we will fulfill your request as best as possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. We kindly recommend contacting your local distributors for specific delivery time estimates.
As a standard practice, all our proteins are shipped with regular blue ice packs. If you require dry ice shipping, please communicate your request in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. It is advisable to store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. To enhance long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution for storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference point for your own preparations.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms can be stored for up to 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is necessary to prevent repeated freeze-thaw cycles, which can compromise protein integrity.
Tag Info
The tag type will be determined during the manufacturing process.
We strive to provide the most suitable tag type for each protein. However, if you have a specific tag preference, please let us know, and we will prioritize fulfilling your request during the development process.
Synonyms
arnE; YE2187; Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE; L-Ara4N-phosphoundecaprenol flippase subunit ArnE; Undecaprenyl phosphate-aminoarabinose flippase subunit ArnE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-114
Protein Length
full length protein
Species
Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Target Names
arnE
Target Protein Sequence
MTSYLLLITVSLLTCAGQLCQKQAAQSWALPQHYRLAPTLRWLASAVVLLSLGMLLWLRL LQHLPLSVAYPILSFNFVLVTLAAQFFYGEQATSRHWLGIASIMFGILLISWHL
Uniprot No.

Target Background

Function
This protein functions as a translocator, moving 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (alpha-L-Ara4N-phosphoundecaprenol) across the inner membrane, from the cytoplasmic side to the periplasmic side.
Database Links

KEGG: yen:YE2187

STRING: 393305.YE2187

Protein Families
ArnE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is ArnE in Yersinia enterocolitica and what is its biological significance?

ArnE in Yersinia enterocolitica is a probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit, also known as L-Ara4N-phosphoundecaprenol flippase subunit or undecaprenyl phosphate-aminoarabinose flippase subunit. The protein consists of 114 amino acids and plays a critical role in bacterial membrane modification processes that contribute to antimicrobial resistance mechanisms . The biological significance of ArnE lies in its contribution to the lipopolysaccharide (LPS) modification pathway, specifically in the translocation of aminoarabinose across the cytoplasmic membrane, which ultimately leads to changes in the bacterial outer membrane composition. These modifications can affect bacterial resistance to cationic antimicrobial peptides and certain antibiotics, making ArnE an important factor in Y. enterocolitica pathogenicity and survival within host environments. Understanding ArnE function provides insights into bacterial adaptation mechanisms during infection and potential targets for therapeutic intervention.

How does ArnE differ from other membrane proteins in Yersinia species?

ArnE differs from other membrane proteins in Yersinia species primarily in its specialized function as part of the aminoarabinose transfer system, which is distinct from other membrane transport mechanisms such as the hemin uptake system. Unlike the hemin receptor HemR, which is a 78 kDa iron-regulated outer membrane protein involved in iron acquisition, ArnE is a smaller protein (114 amino acids) functioning as a subunit of a flippase complex in the inner membrane . ArnE contains multiple transmembrane domains as evidenced by its amino acid sequence (MTSYLLLITVSLLTCAGQLCQKQAAQSWALPQHYRLAPTLRWLASAVVLLSLGMLLWLRLLQHLPLSVAYPILSFNFVLVTLAAQFFYGEQATSRHWLGIASIMFGILLISWHL), which contributes to its function in translocating aminoarabinose-modified lipids across membranes . The protein also differs in its regulatory mechanisms, as while many Yersinia membrane proteins like HemR are regulated by iron availability through Fur boxes, ArnE expression is typically induced by environmental signals related to membrane stress and antimicrobial peptide exposure. These distinctive structural and functional characteristics make ArnE a specialized component of Yersinia's membrane modification machinery with unique contributions to bacterial survival strategies.

What are the current challenges in studying ArnE function in Yersinia enterocolitica?

Studying ArnE function in Yersinia enterocolitica presents several distinct challenges related to its membrane-associated nature and functional complexity. Membrane proteins like ArnE are notoriously difficult to study due to their hydrophobicity, which complicates protein purification and structural analysis, often requiring specialized detergents and stabilization techniques . Additionally, ArnE functions as part of a multi-component flippase complex, making it challenging to study its individual contributions separate from its protein partners in the aminoarabinose modification pathway. The relatively small size of ArnE (114 amino acids) presents technical challenges for antibody generation and immunological detection methods compared to larger proteins like HemR (78 kDa) . Another significant challenge lies in developing appropriate functional assays to measure flippase activity in vitro, as these typically require reconstitution of membrane environments and specialized analytical techniques to track lipid translocation. Furthermore, the conditional expression of ArnE under specific environmental conditions means that researchers must carefully control experimental conditions to ensure the protein is expressed at detectable levels for functional studies.

What structural features of ArnE are essential for its flippase activity?

The structural features essential for ArnE flippase activity include its transmembrane domains and specific amino acid motifs that facilitate lipid translocation across membranes. Based on its amino acid sequence (MTSYLLLITVSLLTCAGQLCQKQAAQSWALPQHYRLAPTLRWLASAVVLLSLGMLLWLRLLQHLPLSVAYPILSFNFVLVTLAAQFFYGEQATSRHWLGIASIMFGILLISWHL), ArnE contains multiple hydrophobic regions that form transmembrane helices, which are crucial for its integration into the bacterial inner membrane and for creating a pathway through which aminoarabinose-modified lipids can be translocated . The protein likely contains charged or polar residues at strategic positions that interact with the aminoarabinose moiety during the flipping process, similar to other bacterial flippases. The N-terminal region of ArnE may contain signal sequences that direct its proper insertion into the membrane, while specific motifs in the transmembrane domains likely form the actual pore or channel through which the lipid substrate moves. Structural analysis suggests that ArnE must interact with other proteins in the Arn pathway to form a functional flippase complex, indicating that interface regions for protein-protein interactions are also essential structural features. These structural components work together to enable ArnE's role in translocating aminoarabinose-modified lipids, a critical step in LPS modification and antimicrobial resistance in Y. enterocolitica.

How do recombinant expression systems affect the structure-function relationship of ArnE protein?

Recombinant expression systems can significantly impact the structure-function relationship of ArnE protein through several mechanisms that influence protein folding, post-translational modifications, and functional activity. When expressed in heterologous hosts like E. coli, as described in the product information, ArnE may encounter different membrane environments and protein-folding machinery than in its native Y. enterocolitica context, potentially affecting its proper folding and insertion into membranes . The addition of purification tags, such as the N-terminal His-tag used in the recombinant product, can alter the protein's terminus and potentially interfere with proper folding, membrane insertion, or interactions with other proteins in the flippase complex. Expression conditions including temperature, induction method, and growth media composition can influence the conformational state of the protein, with suboptimal conditions potentially leading to inclusion body formation rather than functional membrane insertion. The recombinant ArnE protein's functionality may be compromised if the heterologous host lacks other components of the Arn modification pathway with which ArnE normally interacts. Despite these potential issues, recombinant expression systems provide valuable tools for obtaining sufficient quantities of protein for structural and functional studies, particularly when optimized to account for membrane protein-specific challenges using approaches such as lower expression temperatures, specialized E. coli strains designed for membrane protein expression, and carefully selected detergents for protein extraction and purification.

What computational approaches can be used to predict functional domains in ArnE?

Computational approaches for predicting functional domains in ArnE encompass a range of bioinformatic tools and methodologies that can reveal important structural and functional features. Transmembrane topology prediction algorithms such as TMHMM, HMMTOP, and Phobius can identify the hydrophobic regions in ArnE that likely form membrane-spanning helices, providing insights into how the protein is oriented within the bacterial membrane . Homology modeling using related flippase proteins with known structures can generate three-dimensional models of ArnE, similar to the I-TESSER server composite modeling approach mentioned for other Yersinia proteins in the research literature . Multiple sequence alignment with ArnE homologs from other bacterial species can identify conserved residues likely crucial for function, while protein family (Pfam) domain analysis can place ArnE within known protein families and predict functional motifs. Molecular dynamics simulations can model how ArnE might interact with its lipid substrate and with other proteins in the Arn pathway, providing mechanistic insights into the flipping process. Protein-protein interaction prediction tools might identify potential binding partners within the aminoarabinose modification pathway, while functional site prediction algorithms can highlight specific amino acids likely involved in substrate binding or catalysis. These complementary computational approaches, when combined with experimental validation, provide a powerful strategy for understanding ArnE structure-function relationships and guiding the design of functional studies.

What are the optimal conditions for expressing and purifying recombinant ArnE protein?

The optimal conditions for expressing and purifying recombinant ArnE protein require careful consideration of host systems, expression parameters, and purification strategies tailored to membrane proteins. Based on available information, E. coli serves as an effective heterologous expression system for ArnE, but expression should be conducted at lower temperatures (typically 16-20°C) to slow protein production and facilitate proper membrane insertion rather than inclusion body formation . Induction conditions should be mild, using lower concentrations of inducers like IPTG (0.1-0.5 mM) for longer periods (16-20 hours) to promote proper folding. Specialized E. coli strains designed for membrane protein expression, such as C41(DE3) or C43(DE3), can improve yields of correctly folded ArnE. For purification, the initial cell lysis step is critical and should include appropriate detergents (such as n-dodecyl-β-D-maltoside or LDAO) at concentrations above their critical micelle concentration to effectively solubilize membrane proteins without denaturation. The His-tagged ArnE protein can be purified using immobilized metal affinity chromatography (IMAC) with buffers containing detergent concentrations above the critical micelle concentration throughout all purification steps . Size exclusion chromatography should follow IMAC to ensure homogeneity of the purified protein and removal of aggregates. The final purified protein should be maintained in a stabilizing buffer containing appropriate detergents or potentially reconstituted into nanodiscs or liposomes to maintain structural integrity, with storage at -80°C in the presence of cryoprotectants like 6% trehalose as mentioned in the product information .

How can researchers effectively measure ArnE-mediated flippase activity in vitro?

Researchers can effectively measure ArnE-mediated flippase activity in vitro through several specialized biochemical and biophysical approaches that track lipid translocation across membranes. One approach involves reconstituting purified ArnE protein into artificial liposomes with fluorescently labeled aminoarabinose-lipid analogs, where the translocation of these lipids from the inner to outer leaflet can be monitored by fluorescence quenching assays or by accessibility to membrane-impermeable reagents. Another effective method employs radiolabeled aminoarabinose substrates in proteoliposomes containing reconstituted ArnE, allowing researchers to track substrate movement using scintillation counting after separating inner and outer membrane leaflets. Stopped-flow spectroscopy can provide real-time kinetic measurements of flippase activity by monitoring fluorescence changes as fluorescent lipid analogs move between membrane leaflets. For more detailed mechanistic studies, researchers might employ surface plasmon resonance (SPR) to measure binding interactions between ArnE and its lipid substrates, providing insights into the affinity and kinetics of these interactions. Complementary approaches include using ArnE-containing proteoliposomes to measure protection against antimicrobial peptides, indirectly assessing functional aminoarabinose modification of lipids. Each of these methods requires careful optimization of membrane composition, protein-to-lipid ratios, and assay conditions to accurately measure the relatively slow process of membrane lipid translocation, but together they provide powerful tools for characterizing ArnE flippase activity.

What genetic manipulation approaches can be used to study ArnE function in Yersinia enterocolitica?

Genetic manipulation approaches for studying ArnE function in Yersinia enterocolitica encompass a range of molecular techniques that can reveal the protein's biological roles and regulatory mechanisms. Gene knockout or deletion studies represent a fundamental approach, where researchers can create arnE deletion mutants using homologous recombination or CRISPR-Cas9 systems to assess the phenotypic consequences on antimicrobial peptide resistance, LPS modification, and bacterial virulence . Complementary to deletion studies, site-directed mutagenesis of specific amino acids in ArnE can identify critical residues for function, where targeted mutations in predicted functional domains can be introduced back into arnE knockout strains to assess which residues are essential for activity. For studying expression patterns, transcriptional or translational fusions of the arnE promoter or gene with reporter systems like lacZ or fluorescent proteins can reveal when and where ArnE is expressed under different environmental conditions. Conditional expression systems such as inducible promoters can control ArnE expression levels, allowing researchers to examine the effects of different protein concentrations on bacterial physiology. For more complex studies, researchers can employ methods similar to those used with other Yersinia proteins, such as constructing chimeric proteins between ArnE and related flippases to identify domain-specific functions, as demonstrated in studies with other Yersinia membrane proteins . Additionally, transposon mutagenesis libraries can identify other genes that functionally interact with arnE, revealing the broader genetic network in which it operates. These genetic approaches, when combined with phenotypic and biochemical analyses, provide powerful tools for understanding ArnE function in its native bacterial context.

How does ArnE contribute to antimicrobial resistance in Yersinia enterocolitica?

ArnE contributes to antimicrobial resistance in Yersinia enterocolitica through its critical role in lipopolysaccharide modification pathways that reduce bacterial susceptibility to cationic antimicrobial peptides and certain antibiotics. As a component of the 4-amino-4-deoxy-L-arabinose (L-Ara4N) modification system, ArnE functions as a flippase subunit that facilitates the translocation of aminoarabinose-modified lipid carriers across the cytoplasmic membrane, a crucial step in the pathway that ultimately results in the addition of positively charged L-Ara4N to the lipid A portion of LPS . This modification reduces the net negative charge of the bacterial outer membrane, decreasing the electrostatic attraction between the membrane and cationic antimicrobial peptides, including host defense peptides like defensins and cathelicidins as well as cationic antibiotics such as polymyxins. The aminoarabinose modification pathway, including ArnE function, is typically activated in response to environmental signals that bacteria encounter during infection, such as low Mg2+ concentrations and acidic pH, suggesting it plays a role in adaptation to host environments. Genetic studies with related systems indicate that disruption of this pathway significantly increases bacterial susceptibility to antimicrobial peptides, highlighting ArnE's importance in this resistance mechanism. By contributing to LPS modification, ArnE plays a critical role in Y. enterocolitica's defensive strategies against host immune effectors and certain therapeutic agents, making it an important factor in bacterial survival during infection.

What is the relationship between ArnE and the immune response to Yersinia enterocolitica infection?

The relationship between ArnE and the immune response to Yersinia enterocolitica infection involves complex interactions between bacterial LPS modifications and host immune recognition systems. Although not directly addressed in the provided research materials, the function of ArnE in LPS modification likely has significant implications for immune recognition and response. The addition of aminoarabinose to lipid A, facilitated by the ArnE flippase activity, can alter the structure of LPS, potentially affecting its recognition by host pattern recognition receptors such as TLR4, which detects bacterial LPS and initiates inflammatory responses . These modifications might help Y. enterocolitica evade innate immune detection or modulate the intensity of the inflammatory response during infection. Research on related Yersinia species suggests that LPS modifications can affect the production of pro-inflammatory cytokines including TNF-α, IFN-γ, IL-2, and IL-12, which are crucial for controlling Yersinia infections as demonstrated in studies with the rVE fusion protein . In the context of adaptive immunity, altered LPS structures resulting from ArnE-mediated modifications might influence the development of antibody responses, potentially affecting the balance between Th1 and Th2 immune polarization, similar to how different Yersinia antigens can drive distinct IgG isotype profiles and T-cell subset activation as seen with rV and rE proteins . Understanding how ArnE-dependent LPS modifications influence these immune parameters could provide valuable insights into Y. enterocolitica pathogenesis and inform the development of more effective vaccines and immunotherapeutic approaches.

How does ArnE interact with other components of the aminoarabinose modification pathway?

ArnE interacts with other components of the aminoarabinose modification pathway through specific protein-protein interactions that form a functional membrane-associated complex for lipid translocation. Although the specific interactions for Y. enterocolitica ArnE are not directly detailed in the provided research materials, insights can be drawn from related bacterial systems. ArnE likely functions as part of a flippase complex that includes its partner protein ArnF, with which it forms a heterodimeric structure spanning the cytoplasmic membrane . This ArnE-ArnF complex would interact with upstream enzymes in the pathway that synthesize and transfer aminoarabinose to the lipid carrier, including ArnA (a bifunctional enzyme involved in aminoarabinose synthesis), ArnB (an aminotransferase), ArnC (a transferase that attaches aminoarabinose to the lipid carrier), and ArnD (which processes the aminoarabinose-lipid intermediate). The functional complex would also interface with downstream components like ArnT, the transferase that ultimately attaches aminoarabinose from the flipped lipid carrier to lipid A in the periplasm. These interactions likely involve specific interface regions on ArnE, including loop regions between transmembrane domains and terminal segments that extend into the cytoplasm or periplasm. The proper assembly and coordination of this multi-protein complex is essential for the complete aminoarabinose modification pathway, and disruption of any component, including ArnE, can compromise the bacterial resistance mechanisms dependent on LPS modification. Future research using techniques such as bacterial two-hybrid systems, co-immunoprecipitation, cross-linking studies, or fluorescence resonance energy transfer (FRET) could further elucidate the specific protein-protein interactions involving ArnE in this important modification pathway.

How might structural modifications to recombinant ArnE enhance its utility in antibody production and structural studies?

Structural modifications to recombinant ArnE could significantly enhance its utility in antibody production and structural studies through targeted alterations that improve protein stability, solubility, and immunogenicity. For antibody production, removing or replacing highly hydrophobic transmembrane regions with short linker sequences could increase solubility while preserving key antigenic epitopes, making the modified protein more suitable for immunization . Creating a truncated version of ArnE that retains only the most immunogenic extracellular or periplasmic domains could focus the immune response on accessible epitopes that would recognize the native protein in its membrane context. For structural studies, fusion partners such as maltose-binding protein or glutathione S-transferase could be employed instead of or in addition to the His-tag to enhance solubility and provide additional purification options beyond what is currently used for the recombinant protein . Incorporating specific mutations to remove potential sites of aggregation or proteolytic degradation could improve protein stability during expression and purification, while adding strategic disulfide bonds might stabilize the tertiary structure in detergent solutions. For crystallography attempts, creating fusion constructs with crystallization chaperones like T4 lysozyme or thermostabilized apocytochrome b562RIL inserted into loop regions could provide crystal contacts without disrupting core structure. Nanobody-aided crystallization, where antibody fragments are used to stabilize flexible regions, represents another approach that has been successful with challenging membrane proteins. For cryo-electron microscopy studies, increasing the molecular weight through appropriate fusion partners could improve particle visibility and orientation determination. Each of these modifications would require careful design based on computational predictions of ArnE structure and targeted experimental validation to ensure that the modified protein retains relevant structural and functional properties.

What emerging technologies could advance our understanding of ArnE's role in bacterial membrane modification?

Emerging technologies hold significant promise for advancing our understanding of ArnE's role in bacterial membrane modification through novel approaches to studying membrane protein structure, dynamics, and function. Cryo-electron microscopy (cryo-EM) with advanced detectors and processing algorithms could potentially determine the structure of ArnE within its native membrane environment or in complex with other components of the aminoarabinose modification pathway, providing insights impossible to obtain through conventional crystallography . Single-molecule fluorescence techniques such as FRET and single-particle tracking could reveal the dynamic behavior of ArnE during the flipping process, capturing conformational changes and interactions with lipid substrates in real-time. Native mass spectrometry adapted for membrane proteins could determine the precise stoichiometry and composition of ArnE-containing complexes, while hydrogen-deuterium exchange mass spectrometry could map regions involved in protein-protein or protein-lipid interactions. Molecular dynamics simulations using specialized force fields for membrane environments, combined with enhanced sampling techniques, could model the energetics and mechanism of aminoarabinose-lipid translocation at atomic resolution. CRISPR interference (CRISPRi) approaches could enable fine-tuned control of arnE expression, allowing precise correlation between protein levels and antimicrobial resistance phenotypes. Bacterial cytological profiling combined with super-resolution microscopy could visualize ArnE localization and membrane domain organization in living bacteria under various environmental conditions. Microfluidic systems that mimic host environmental conditions could assess how ArnE function adapts to changing environments encountered during infection. These emerging technologies, often used in combination, have the potential to provide unprecedented insights into ArnE structure, function, and regulation, advancing our fundamental understanding of bacterial membrane modification processes and potentially revealing new approaches for therapeutic intervention.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.