Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
arnF; YE2186; Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF; L-Ara4N-phosphoundecaprenol flippase subunit ArnF; Undecaprenyl phosphate-aminoarabinose flippase subunit ArnF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Target Names
arnF
Target Protein Sequence
MKGYGWGIGSVVLVTVAQLILKWGMMNTPLMSLADINGQFVFNHLPQFIAVICGLAGYAL SMLCWFFALRYLPLNRAYPLLSLSYALVYLGAVSLPWFSESATLLKTLGAGFILLGIWLI NTKPIAKD
Uniprot No.

Target Background

Function

This protein functions as a probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit. It translocates 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (α-L-Ara4N-phosphoundecaprenol) across the inner membrane, from the cytoplasmic to the periplasmic side.

Database Links

KEGG: yen:YE2186

STRING: 393305.YE2186

Protein Families
ArnF family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the ArnF protein and what role does it play in Y. enterocolitica pathogenicity?

ArnF is a probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit that likely contributes to lipopolysaccharide (LPS) modification in Y. enterocolitica. Similar to other virulence factors identified in pathogenic Yersinia species, ArnF may contribute to bacterial survival during infection. Based on studies of Y. enterocolitica virulence mechanisms, proteins involved in cell envelope modification often play crucial roles in pathogenicity by contributing to resistance against host defense mechanisms, particularly during systemic infection . Researchers should approach ArnF characterization using methods similar to those employed for systemic infection factors (sif genes), which have been successfully identified through in vivo selection techniques in mouse models .

What genetic techniques are most effective for characterizing the arnF gene in Y. enterocolitica?

For effective characterization of the arnF gene, researchers should consider a multifaceted approach:

  • Gene disruption: Create insertional mutations using transposons like TnMax2, which has been successfully employed for characterizing Y. enterocolitica genes . This technique allows for precise interruption of the arnF coding sequence.

  • Complementation analysis: Construct a complementation plasmid containing the wild-type arnF allele to confirm phenotypes of mutants, similar to approaches used for other Y. enterocolitica genes .

  • PCR-based analysis: Employ overlap extension PCR techniques, which have been successfully used to construct mutagenic DNA fragments for Y. enterocolitica studies .

  • Sequencing verification: Confirm all genetic modifications with sequencing using primers that hybridize to regions flanking the arnF gene, as demonstrated in other Y. enterocolitica genetic studies .

How should researchers establish appropriate control conditions when studying arnF expression?

When studying arnF expression, researchers should implement multiple controls:

  • Strain controls: Include both the wild-type Y. enterocolitica serotype O:8/biotype 1B strain and isogenic arnF mutant strains in all experiments .

  • Temperature conditions: Conduct experiments at both 26°C and 37°C, as temperature significantly affects gene expression in Y. enterocolitica, as demonstrated in urease studies .

  • Growth phase standardization: Standardize cultures to specific growth phases, as virulence gene expression in Y. enterocolitica varies depending on growth phase .

  • Complementation controls: Include complemented mutant strains (arnF mutant carrying a plasmid with wild-type arnF) to verify that observed phenotypes are specifically due to arnF disruption rather than polar effects .

What in vivo selection strategies can identify conditions where arnF expression is critical?

To identify conditions where arnF expression is critical, researchers can employ in vivo selection strategies similar to those used for identifying systemic infection factors in Y. enterocolitica:

  • Promoter-reporter fusions: Construct arnF promoter fusions to reporter genes like cat (chloramphenicol acetyltransferase) to monitor expression during infection .

  • In vivo passage with selection: Inoculate mice with a library of Y. enterocolitica strains containing various reporter constructs and administer appropriate antibiotics to select for strains expressing the gene of interest during infection .

  • Tissue-specific recovery: Isolate bacteria from different tissues (Peyer's patches, spleen, liver) to determine where arnF expression is most critical .

  • Competitive index assays: Perform mixed infections with wild-type and arnF mutant strains to quantitatively assess the contribution of arnF to colonization of specific tissues, calculating the ratio of mutant to wild-type bacteria recovered from infected tissues compared to the initial inoculum .

How can researchers differentiate between the roles of ArnF in systemic versus localized infections?

To differentiate between systemic and localized infection roles:

  • Tissue-specific virulence assessment: Compare bacterial loads of wild-type and arnF mutant strains in Peyer's patches (localized infection) versus spleen and liver (systemic infection). Studies of other Y. enterocolitica genes have demonstrated that different sets of genes are required for these distinct infection phases .

  • Temporal expression analysis: Monitor arnF expression at different time points during infection to determine when it is most active, using techniques similar to those that revealed temporal expression patterns of sif genes .

  • Infection model selection: Employ both oral infection models (to assess gastrointestinal colonization) and intraperitoneal injection (to directly assess systemic infection capabilities) .

  • Comparative mutant analysis: Compare phenotypes of arnF mutants with mutants in genes known to be specifically involved in either localized or systemic infection phases .

What methodological approaches are most effective for studying ArnF protein-protein interactions?

For studying ArnF protein-protein interactions:

Table 1: Methodological Approaches for ArnF Protein Interaction Studies

MethodApplication to ArnFAdvantagesLimitations
Bacterial Two-HybridScreening for ArnF interaction partnersCan be performed in prokaryotic systems; allows high-throughput screeningMay produce false positives; interaction must occur in bacterial cytoplasm
Co-immunoprecipitationConfirming direct ArnF interactionsDetects physiologically relevant interactionsRequires specific antibodies; may disrupt weak interactions
Pull-down assaysTesting specific ArnF interactionsCan use recombinant tagged proteinsMay not reflect in vivo conditions
Cross-linking studiesCapturing transient ArnF interactionsCan identify brief or weak interactionsMay generate complex product mixtures
Blue Native PAGEAnalyzing intact ArnF-containing complexesMaintains native protein complexesLimited resolution for very large complexes

When implementing these approaches, researchers should consider the membrane-associated nature of ArnF, which may necessitate modified protocols to maintain protein solubility and native conformation .

How does environmental pH affect arnF expression and function in Y. enterocolitica?

The impact of pH on arnF expression should be investigated systematically:

  • pH-dependent expression analysis: Quantify arnF expression across a pH range (pH 4.0-8.0) using qRT-PCR or reporter fusions. This approach is supported by studies showing that OmpR, a regulator in Y. enterocolitica, influences acid survival capabilities .

  • Acid survival assays: Compare survival of wild-type and arnF mutant strains at acidic pH (e.g., pH 4.0) for defined periods (e.g., 90 minutes), calculating survival percentages relative to neutral pH conditions .

  • Complementation testing under acidic conditions: Assess whether providing arnF in trans can restore acid survival capabilities to arnF mutants, similar to approaches used for ompR mutants .

  • Mechanistic investigation: Determine whether ArnF contributes to acid resistance through LPS modification by analyzing LPS profiles of wild-type and arnF mutant strains grown under different pH conditions .

What is the relationship between ArnF and antimicrobial peptide resistance in Y. enterocolitica?

To investigate ArnF's role in antimicrobial peptide resistance:

  • Minimum inhibitory concentration (MIC) determination: Compare MICs of various antimicrobial peptides (polymyxin B, LL-37, defensins) against wild-type and arnF mutant Y. enterocolitica strains.

  • LPS modification analysis: Assess whether ArnF affects the addition of 4-amino-4-deoxy-L-arabinose to lipid A, which typically confers resistance to cationic antimicrobial peptides. This can be done through mass spectrometric analysis of purified LPS from wild-type and arnF mutant strains.

  • Gene expression correlation: Analyze whether arnF expression correlates with expression of other genes known to be involved in antimicrobial peptide resistance, potentially through RNA-seq analysis of bacteria exposed to sublethal concentrations of antimicrobial peptides .

  • In vivo relevance testing: Determine whether arnF mutants show attenuated virulence in animal models where antimicrobial peptides play significant roles in host defense .

What are the optimal methods for expressing and purifying recombinant ArnF for structural studies?

For optimal expression and purification of recombinant ArnF:

Table 2: Expression Systems for Recombinant ArnF Production

Expression SystemAdvantages for ArnF ProductionConsiderationsPurification Strategy
E. coli BL21(DE3)High yield; well-established protocolsMay need codon optimization for Y. enterocolitica genesIMAC with C-terminal His-tag
E. coli C43(DE3)Specialized for membrane proteinsLower yield but better folding for membrane proteinsTwo-step: IMAC followed by size exclusion
Cell-free expressionAvoids toxicity issues; direct incorporation into nanodiscsHigher cost; optimization requiredAffinity purification with multiple tags
Y. enterocolitica expressionNative environment; proper foldingLower yield; more complex purificationGentle detergent extraction followed by affinity purification

Key methodological considerations include:

  • Expression temperature optimization (typically lower temperatures improve membrane protein folding)

  • Detergent screening for optimal solubilization while maintaining native structure

  • Validation of proper folding using circular dichroism or limited proteolysis approaches

How can CRISPR-Cas9 technology be applied to study arnF function in Y. enterocolitica?

CRISPR-Cas9 applications for arnF studies include:

  • Precise genome editing: Generate clean deletions or point mutations in arnF without leaving marker genes or scars, enabling precise structure-function studies.

  • CRISPRi for conditional knockdown: Deploy catalytically inactive Cas9 (dCas9) fused to transcriptional repressors to achieve tunable repression of arnF, allowing assessment of dose-dependent effects on virulence.

  • Multiplexed editing: Simultaneously target arnF and related genes to investigate functional redundancy and complex phenotypes.

  • Base editing: Introduce specific amino acid substitutions without double-strand breaks to study structure-function relationships within ArnF.

Implementation considerations include:

  • Optimization of guide RNA design for Y. enterocolitica

  • Development of appropriate delivery methods (electroporation protocols, temperature-sensitive plasmids)

  • Establishment of screening methods to identify successful editing events

What techniques are most effective for studying the membrane topology and localization of ArnF?

For membrane topology and localization studies:

  • Reporter fusion analysis: Create systematic fusions of reporter enzymes (alkaline phosphatase, β-galactosidase) to different positions within ArnF to map membrane topology based on reporter activity.

  • Fluorescent protein tagging: Generate ArnF fusions with fluorescent proteins to visualize cellular localization using super-resolution microscopy.

  • Cysteine accessibility methods: Introduce cysteine residues at various positions in a cysteine-less ArnF variant, then use membrane-permeable and -impermeable thiol-reactive reagents to determine which regions are accessible from which side of the membrane.

  • Protease protection assays: Treat membrane preparations containing epitope-tagged ArnF with proteases, then analyze protected fragments to determine membrane-embedded regions.

These approaches should be complemented with computational prediction tools, though experimental validation remains essential for membrane proteins like ArnF .

How should researchers interpret conflicting data about ArnF function from different experimental models?

When confronted with conflicting data about ArnF function:

  • Cross-model validation: Systematically compare results across multiple experimental systems (in vitro assays, cell culture infection models, animal models), recognizing that each model has specific limitations.

  • Strain-specific effects: Consider that ArnF function may differ between Y. enterocolitica strains, as observed with urease activity between strains Ye9N and Ye8N .

  • Environmental context: Evaluate whether discrepancies arise from different experimental conditions (temperature, pH, growth phase), as these significantly impact Y. enterocolitica gene expression .

  • Technical approach assessment: Compare methodological details between conflicting studies, as differences in experimental techniques (e.g., recombinant protein production methods, genetic modification approaches) can influence outcomes .

  • Biological replication: Ensure sufficient biological replicates and appropriate statistical analysis to distinguish real effects from experimental variability .

What statistical approaches are most appropriate for analyzing differential arnF expression data?

For analyzing differential arnF expression:

  • Normalization approaches: Use multiple reference genes that maintain stable expression under experimental conditions to normalize qRT-PCR data for arnF expression.

  • Temporal expression analysis: When analyzing expression over time or across conditions, employ repeated measures ANOVA or mixed-effects models to account for time-dependent correlations.

  • Multiple comparison corrections: Apply appropriate corrections (Bonferroni, Benjamini-Hochberg) when testing arnF expression across multiple conditions to control false discovery rates.

  • Data transformation considerations: Assess whether log transformation of expression data is necessary to meet assumptions of parametric tests, particularly for data with exponential growth phases.

  • Power analysis: Conduct a priori power analysis to determine sample sizes needed to detect biologically meaningful differences in arnF expression between conditions .

How does the arnF gene differ across Yersinia species and what are the functional implications?

A comparative genomic analysis of arnF should address:

  • Sequence conservation: Analyze arnF sequence conservation across Yersinia species, particularly comparing highly pathogenic strains like Y. enterocolitica biotype 1B/O:8 with less virulent strains.

  • Synteny analysis: Examine the genomic context of arnF across Yersinia species to identify conserved operonic structures or regulatory elements.

  • Selection pressure assessment: Calculate Ka/Ks ratios to determine whether arnF is under purifying or diversifying selection in different Yersinia lineages.

  • Horizontal gene transfer evaluation: Investigate whether arnF shows evidence of horizontal acquisition through analysis of GC content, codon usage bias, and phylogenetic incongruence.

  • Structure-function prediction: Use comparative sequence analysis to predict functionally important domains and residues that could be targeted for subsequent experimental validation .

What bioinformatic approaches can help predict ArnF interaction partners and functional networks?

For predicting ArnF interaction networks:

Table 3: Bioinformatic Approaches for ArnF Functional Network Prediction

ApproachApplication to ArnFStrengthsLimitations
Co-expression analysisIdentify genes with similar expression patterns to arnFLeverages existing transcriptomic datasetsCorrelation doesn't prove functional relationship
Protein-protein interaction databasesSearch for known interactions with homologs of ArnFBased on experimental evidenceLimited data for Y. enterocolitica proteins
Gene neighborhood analysisExamine genes located near arnF in multiple genomesIdentifies functionally related genesMay miss distant functional partners
Structural homology modelingPredict ArnF structure and potential interaction interfacesProvides mechanistic insightsAccuracy depends on available templates
Phylogenetic profilingIdentify genes with similar presence/absence patterns across speciesReveals evolutionarily linked genesMay miss recently evolved interactions

Integration of multiple approaches provides the most robust predictions, which should be experimentally validated .

How can understanding ArnF function contribute to novel antimicrobial development?

The translational potential of ArnF research includes:

  • Target validation: Determine whether inhibition of ArnF function significantly attenuates Y. enterocolitica virulence in relevant infection models, establishing its potential as an antimicrobial target.

  • High-throughput screening approaches: Develop assays that measure ArnF flippase activity to screen for inhibitory compounds, potentially adapting methodologies used for other bacterial flippases.

  • Structure-guided drug design: Use structural information about ArnF (from crystallography or cryo-EM studies) to design small molecule inhibitors targeting critical functional domains.

  • Species-specificity assessment: Compare ArnF to host transporters to identify bacterial-specific features that could be targeted to minimize toxicity of potential inhibitors.

  • Resistance development evaluation: Assess the potential for resistance development by selecting for Y. enterocolitica strains that can grow in the presence of ArnF inhibitors and characterizing resistance mechanisms .

What are the methodological considerations for studying ArnF's role in host-pathogen interactions?

When investigating ArnF's role in host-pathogen interactions:

  • Cell type selection: Consider the relevance of different cell types (epithelial cells, macrophages, neutrophils) based on the tissues Y. enterocolitica typically infects, as different virulence factors may be important in different cellular contexts .

  • Infection timeline: Develop sampling strategies that capture the dynamic nature of infection, from initial attachment to invasion and systemic spread, as ArnF may play different roles at different stages .

  • Host response measurement: Employ methods that quantify relevant host responses (cytokine production, antimicrobial peptide release, phagocytosis efficiency) to determine how ArnF affects host-pathogen interactions.

  • In vivo imaging considerations: If using in vivo imaging to track infection progression, ensure that reporter systems do not interfere with ArnF function or bacterial fitness.

  • Bacterial population heterogeneity: Consider single-cell approaches to assess whether ArnF expression or function varies within the bacterial population during infection .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.