Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Probable ubiquinone biosynthesis protein UbiB (ubiB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months under the same conditions.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag is determined during production. Please specify your required tag type for preferential development.
Synonyms
ubiB; YE0258; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-543
Protein Length
full length protein
Species
Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Target Names
ubiB
Target Protein Sequence
MTPGELRRLYLIIRVFLSYGLDELIPNIRLTLPLRVGRHLFFWLPNRHKDKPLGERLRLA LQELGPVWIKFGQMMSTRRDLFPPAIADQLALLQDRVAPFDGALARKHIEIAMGGPLETW FDDFEQEALASASIAQVHTARLKENGQEVVLKVIRPDILPIIKADVRLMYRLAGWVPKLL PDGRRLRPREVVREYEKTLLDELNLLREAANAIQLRRNFEDSPMLYIPEVYSDYCRESVL VMERIYGIPVSDIAALEDQGTNMKLLAERGVQVFFTQVFRDSFFHADMHPGNIFVSYEHP HDPLYIGIDCGIVGSLNKADKRYLAENFIAFFNRDYRRVAELHVDSGWVPCDTNVEDFEF AIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQPQLVLLQKTLLYVEGLGRQLYP QLDLWTTAKPFLESWLRDQVGLPAVIRALKEKAPFWAEKFPELPELVYDSLQQHKLLQQS VDKLTTQMQGQQQRQGQSRYLFGVGATLLVSGTILFLANAVEISIGFIVAGVLAWFIGWR RTS
Uniprot No.

Target Background

Function
This protein likely functions as a protein kinase regulator of UbiI activity, which is involved in aerobic coenzyme Q (ubiquinone) biosynthesis.
Database Links

KEGG: yen:YE0258

STRING: 393305.YE0258

Protein Families
ABC1 family, UbiB subfamily
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the functional role of UbiB in Yersinia enterocolitica?

UbiB in Y. enterocolitica is a probable ubiquinone biosynthesis protein involved in the production of coenzyme Q (ubiquinone), which is essential for the electron transport chain in cellular respiration. Based on studies of related UbiB family proteins, it likely functions in a similar manner to COQ8 in other organisms, which is required for coenzyme Q biosynthesis . The protein belongs to a larger family of UbiB proteins that includes kinases and pseudo-kinases that are critical for maintaining proper cellular energy metabolism in bacteria.

What is the relationship between UbiB and virulence in Y. enterocolitica?

The relationship between UbiB and virulence in Y. enterocolitica has not been fully characterized, but evidence suggests that ubiquinone biosynthesis may contribute to bacterial survival under host-induced stress conditions. Y. enterocolitica, which causes yersiniosis affecting the intestinal tract, requires robust energy metabolism during infection . Since UbiB is involved in ubiquinone production, which is essential for electron transport and energy generation, disruption of UbiB function may impair the bacterium's ability to survive oxidative stress encountered during host infection, potentially affecting virulence.

What expression systems are most effective for producing recombinant Y. enterocolitica UbiB protein?

For recombinant expression of Y. enterocolitica UbiB, E. coli-based expression systems (particularly BL21(DE3) strains) often provide high yields with proper optimization. The methodology should include:

  • Gene cloning into vectors with strong inducible promoters (pET series)

  • Optimization of induction conditions (IPTG concentration, temperature, and duration)

  • Addition of a purification tag (6xHis, GST, or MBP) to facilitate isolation

  • Cell lysis using methods that preserve protein activity (sonication or French press)

  • Purification through affinity chromatography followed by size exclusion

Similar methodologies have been successfully applied for other Y. enterocolitica proteins, such as the recombinant bivalent fusion protein rVE comprising regions of LcrV and YopE . Expression yields can be optimized by testing various E. coli strains and induction conditions, with typical yields ranging from 5-15 mg/L culture.

What purification strategy yields the highest purity and activity for recombinant UbiB?

A multi-step purification strategy is recommended for obtaining high-purity, active UbiB protein:

Purification StepMethodExpected PurityNotes
Initial CaptureImmobilized metal affinity chromatography (IMAC)70-80%Optimize imidazole concentration to minimize non-specific binding
Intermediate PurificationIon exchange chromatography85-90%Select column based on theoretical pI of UbiB
PolishingSize exclusion chromatography>95%Helps remove aggregates and assess oligomeric state
OptionalTag removal and reverse IMAC>98%Only if tag-free protein is required

After purification, validation of protein identity can be performed using mass spectrometry and Western blotting, while activity assays should be designed to assess ATP binding and potential kinase activity. This approach parallels methods used for other recombinant Y. enterocolitica proteins in structural and functional studies .

What are the optimal conditions for assessing UbiB enzymatic activity?

Based on studies of related UbiB family proteins, the following conditions are recommended for assessing UbiB enzymatic activity:

  • Buffer composition: 50 mM Tris-HCl (pH 7.5-8.0), 100-150 mM NaCl, 5-10 mM MgCl₂

  • Temperature: 25-30°C (native conditions for Y. enterocolitica)

  • Cofactors: ATP (1-5 mM), potential requirement for metal ions (Mg²⁺, Mn²⁺)

  • Substrates: Ubiquinone precursors (specific substrate may require identification)

  • Detection methods:

    • ATP hydrolysis assay (malachite green phosphate detection)

    • LC-MS/MS to monitor conversion of ubiquinone precursors

    • Coupled enzyme assays to detect ADP production

Since UbiB proteins may function as kinases or pseudo-kinases, assays should be designed to detect both phosphorylation events and potential non-canonical functions like protein-protein interactions .

How does the structure of UbiB contribute to its function in ubiquinone biosynthesis?

The structure-function relationship of UbiB proteins can be analyzed using approaches similar to those employed for other bacterial proteins. Computational structure prediction methods like I-TASSER can generate initial models based on homology to known structures . These models should be refined using energy minimization with tools like GROMOS96 43B1 force field and validated through Ramachandran plot analysis using PROCHECK .

Key structural features likely include:

  • An ATP-binding pocket with characteristic Walker A and B motifs

  • A substrate-binding domain specific for ubiquinone precursors

  • Potential interaction surfaces for other proteins in the ubiquinone biosynthesis pathway

Site-directed mutagenesis of conserved residues followed by activity assays would help identify critical amino acids involved in ATP binding, substrate recognition, and catalysis. Structural studies would benefit from circular dichroism (CD) spectroscopy to assess secondary structure and thermal stability prior to crystallization attempts.

What is the role of UbiB in the electron transport chain of Y. enterocolitica and how does it affect bacterial metabolism?

UbiB's role in Y. enterocolitica metabolism centers on ubiquinone biosynthesis, which directly impacts electron transport chain (ETC) function. To investigate this relationship, researchers should consider:

  • Metabolic flux analysis comparing wild-type and UbiB-deficient strains

  • Measurement of intracellular ubiquinone levels using HPLC or LC-MS/MS

  • Oxygen consumption rates under various growth conditions

  • ATP production and NADH/NAD⁺ ratios as indicators of ETC efficiency

Given that Y. enterocolitica is a facultative anaerobe, UbiB's importance likely varies with oxygen availability. Under aerobic conditions, ubiquinone serves as the primary electron carrier in the ETC, while under anaerobic conditions, alternative terminal electron acceptors may be utilized. This relationship to central metabolism makes UbiB a potential target for antimicrobial development, similar to approaches targeting COQ8 in other systems .

How do inhibitors of UbiB affect Y. enterocolitica survival and virulence?

The development of UbiB inhibitors could provide valuable research tools and potential therapeutic leads. Based on research with COQ8 inhibitors , potential approaches include:

  • High-throughput screening of compound libraries against purified recombinant UbiB

  • Structure-based drug design utilizing homology models or crystal structures

  • Evaluation of known ATP-competitive kinase inhibitors for cross-reactivity with UbiB

Potential Inhibitor ClassesMechanismExpected Effects on Y. enterocolitica
ATP-competitive inhibitorsBlock ATP binding siteReduced ubiquinone synthesis, impaired respiration
Allosteric inhibitorsAlter protein conformationModified UbiB activity, potentially strain-specific effects
Covalent inhibitorsForm irreversible bonds with key residuesComplete inhibition, potential for resistance development

Effects on virulence should be assessed in cellular infection models measuring bacterial survival, inflammatory responses, and host cell cytotoxicity. Animal models of yersiniosis would provide in vivo validation of promising inhibitors. The potency of such inhibitors would need to be balanced against potential toxicity to host mitochondrial ubiquinone biosynthesis.

How does UbiB expression change during different stages of Y. enterocolitica infection?

UbiB expression during Y. enterocolitica infection likely follows patterns similar to other metabolic genes that respond to host environmental cues. To characterize these changes, researchers should:

  • Perform transcriptomic analysis (RNA-Seq) of bacteria recovered from different infection stages and tissues

  • Develop reporter systems (e.g., ubiB promoter-GFP fusions) to monitor real-time expression during infection

  • Conduct proteomics to quantify UbiB protein levels in bacteria isolated from host tissues

Y. enterocolitica encounters various stressors during infection, including pH changes, nutrient limitation, and host immune responses . These conditions likely influence UbiB expression, with potential upregulation during intestinal colonization when robust energy metabolism is required for rapid proliferation. Correlation with expression patterns of known virulence factors would help contextualize UbiB's role in the infection process.

Could UbiB serve as a target for developing vaccines against Y. enterocolitica?

UbiB's potential as a vaccine target should be evaluated in the context of current Y. enterocolitica vaccine development strategies. Research on bivalent fusion proteins like rVE (comprising LcrV and YopE regions) has demonstrated successful induction of both humoral and cell-mediated immune responses against Y. enterocolitica .

For UbiB as a vaccine candidate, considerations include:

  • Antigen accessibility: As a metabolic enzyme, UbiB may not be naturally exposed to the immune system

  • Conservation across strains: High conservation would provide broad protection

  • Immunogenicity: UbiB should stimulate robust immune responses

  • Formulation approaches:

    • Recombinant protein subunit vaccines with appropriate adjuvants

    • DNA vaccines encoding UbiB

    • Fusion constructs combining UbiB with known immunogenic proteins

The bivalent approach used with rVE, which demonstrated superior protection (100% survival) compared to single-antigen vaccines , suggests that combining UbiB with surface-exposed antigens might enhance vaccine efficacy by targeting multiple aspects of bacterial physiology.

How does UbiB contribute to Y. enterocolitica survival under host-induced stress conditions?

UbiB likely contributes to Y. enterocolitica stress resistance through maintaining efficient energy production via ubiquinone biosynthesis. This relationship can be studied through:

  • Comparing survival of wild-type and UbiB-deficient strains under:

    • Oxidative stress (H₂O₂, reactive oxygen species)

    • Nitrosative stress (NO donors)

    • Nutrient limitation

    • Antimicrobial peptides

  • Measuring redox balance indicators (GSH/GSSG ratio, protein carbonylation)

  • Assessing membrane integrity and potential under stress conditions

Given that Y. enterocolitica causes intestinal infections with symptoms including diarrhea and abdominal pain , the bacterium must withstand various host defenses. Ubiquinone's antioxidant properties may help neutralize reactive oxygen species produced by host immune cells, while efficient energy metabolism supported by functional UbiB would facilitate adaptation to changing host environments during infection progression.

What new technologies could advance our understanding of UbiB function in Y. enterocolitica?

Emerging technologies that could significantly advance UbiB research include:

  • CRISPR-Cas9 genome editing for precise manipulation of ubiB and related genes

  • Cryo-electron microscopy for high-resolution structural analysis

  • Metabolomics approaches to comprehensively profile changes in ubiquinone-related metabolites

  • Single-cell analysis techniques to study heterogeneity in UbiB expression within bacterial populations

  • Biomolecular NMR to characterize protein-protein interactions involving UbiB

These approaches would build upon established methods used in studies of other Y. enterocolitica proteins, such as the computational modeling and biochemical techniques used to characterize the rVE fusion protein . Integration of multiple technologies would provide a systems-level understanding of UbiB's role in bacterial physiology and pathogenesis.

How might comparative studies of UbiB across Yersinia species inform therapeutic strategies?

Comparative studies of UbiB across Yersinia species (including Y. enterocolitica, Y. pseudotuberculosis, and Y. pestis) would provide valuable insights for therapeutic development. These species cause distinct diseases, from gastrointestinal infection to plague , yet share core metabolic pathways.

Research approaches should include:

  • Phylogenetic analysis of UbiB sequences to identify conserved and variable regions

  • Functional complementation studies to assess interchangeability of UbiB proteins

  • Comparative biochemical characterization of purified UbiB proteins

  • Evaluation of species-specific inhibitors based on structural differences

Understanding UbiB conservation and divergence across Yersinia species could reveal:

  • Common vulnerabilities for broad-spectrum therapeutics

  • Species-specific features for selective targeting

  • Evolutionary adaptations related to different infection niches

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.