Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Enzymatic Function and Biological Significance

Lgt is an integral membrane enzyme essential for post-translational lipid modification in Gram-negative bacteria. It recognizes the "lipobox" motif (consensus sequence: [LVI][ASTVI][GAS]C) of prolipoproteins and transfers the diacylglyceryl moiety, a prerequisite for subsequent lipoprotein processing . Deletion of the lgt gene is lethal in many bacterial species, underscoring its indispensability .

Key Functional Features:

  • Catalytic Activity: Transfers diacylglyceryl from phosphatidylglycerol to the thiol group of prolipoproteins .

  • Structural Insights: Crystal structures of homologs (e.g., E. coli Lgt) reveal a periplasmic-facing active site with two phosphatidylglycerol-binding pockets, enabling lateral substrate entry/exit .

  • Essential Residues: Arg143 and Arg239 are critical for enzymatic activity, as shown by mutagenesis studies .

Recombinant Production and Characterization

Recombinant Lgt from Y. enterocolitica serotype O:8/biovar 1B (strain 8081) has been expressed in multiple heterologous systems for research and therapeutic development.

Expression SystemPurityApplications
E. coli≥85% (SDS-PAGE)Structural studies, enzyme activity assays
Yeast/Baculovirus≥85% (SDS-PAGE)Vaccine development, antibody production
Mammalian Cells≥85% (SDS-PAGE)Immunogenicity studies
Cell-Free Expression≥85% (SDS-PAGE)High-throughput screening

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
lgt; YE3318; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Target Names
lgt
Target Protein Sequence
MSNSYLAFPKFDPVIFSIGPVSLHWYGLMYLVGFVFAMWLAVRRANKPGSGWTKEEVENL LYAGFLGVFVGGRVGYVLFYNLPLFLDNPLYLFKVWDGGMSFHGGLIGVICVMLWFARRT KRHFFQVADFIAPLIPFGLGAGRLGNFINGELWGRVTTDTPWAMLFPTSRGEDIAIVAAD PAKWQAIFNQYGVLPRHPSQLYEMILEGVVLFIILNLFIRKPRPMGSVSGLFLIGYGAFR IIVECFRQPDAQLGLFDGVISMGQILSVPMILAGIIMMIWAYRRPAQQLS
Uniprot No.

Target Background

Function

This enzyme catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the N-terminal cysteine sulfhydryl group of a prolipoprotein. This is the initial step in the maturation of lipoproteins.

Database Links

KEGG: yen:YE3318

STRING: 393305.YE3318

Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Yersinia enterocolitica and what is the significance of serotype O:8/biotype 1B?

Yersinia enterocolitica is a foodborne bacterial pathogen that causes yersiniosis, an infection that can present with symptoms ranging from acute diarrhea to more severe conditions such as mesenteric adenitis (inflammation of abdominal lymph nodes), terminal ileitis, pseudoappendicitis, and in rare cases, sepsis. The Yersinia genus contains 11 different strains, with three known to cause human disease: Y. pestis, Y. enterocolitica, and Y. pseudotuberculosis. These infections are zoonotic, spreading from animals (primarily pigs) to humans .

Serotype O:8/biotype 1B is particularly significant because it is highly pathogenic compared to other strains. While Y. enterocolitica biotype 1A strains are typically non-pathogenic, biotype 1B (along with biotypes 2, 3, 4, and 5) are associated with human illness. In some regions, Yersinia infections have become more prevalent than other bacterial food poisoning agents like Shigella and Salmonella . Serotype O:8 infections are relatively rare in some regions, such as Japan, but may persist latently in healthy carriers .

What is prolipoprotein diacylglyceryl transferase (lgt) and what is its role in bacterial physiology?

Prolipoprotein diacylglyceryl transferase (Lgt) is an integral membrane enzyme that catalyzes the first reaction in the three-step post-translational lipid modification pathway of bacterial lipoproteins. Specifically, Lgt transfers a diacylglyceryl group from phosphatidylglycerol to a conserved cysteine residue in the lipobox of prolipoprotein substrates, forming a thioether bond .

This enzymatic modification is essential for bacterial survival, particularly in Gram-negative bacteria, where deletion of the lgt gene is typically lethal. Bacterial lipoproteins fulfill diverse and vital biological functions, including:

  • Maintenance of cell envelope architecture

  • Insertion and stabilization of outer membrane proteins

  • Nutrient uptake and transport

  • Adhesion, invasion, and virulence

The lgt pathway is particularly important in Y. enterocolitica as it contributes to the bacterium's pathogenicity and survival within host environments.

How can Yersinia enterocolitica serotype O:8 be differentiated from other strains in a laboratory setting?

Differential identification of Y. enterocolitica serotype O:8 from other strains can be achieved through several laboratory techniques:

  • Chromogenic media: CHROMagarTM Y.enterocolitica provides a selective and differential medium where pathogenic Y. enterocolitica strains (including serotype O:8/biotype 1B) form distinctive mauve colonies after 36-48 hours of aerobic incubation at 30°C ± 2°C. Non-pathogenic strains appear metallic blue or show limited growth. This clear visual differentiation significantly reduces false positives that often occur with traditional media like CIN agar .

  • Biochemical characterization: Y. enterocolitica can be categorized based on biochemical characteristics, with biotype 1B (which includes serotype O:8) having a specific biochemical profile.

  • Serotyping: Specific antisera can be used to identify the O:8 serotype.

  • Molecular typing: PCR-based methods targeting serotype-specific genes and chromosomal DNA analysis can definitively identify serotype O:8 strains and distinguish them from other serotypes .

Using these methods in combination provides the most accurate identification of Y. enterocolitica serotype O:8/biotype 1B isolates for research purposes.

What are the structural characteristics of recombinant Y. enterocolitica lgt and how do they compare to other bacterial lgt proteins?

The structural characteristics of Y. enterocolitica lgt can be inferred from crystal structure studies of the E. coli ortholog, which has provided valuable insights into the enzyme's function. The E. coli Lgt structure has been resolved at high resolution (1.9 Å and 1.6 Å) in complex with phosphatidylglycerol and the inhibitor palmitic acid, respectively .

Key structural features include:

  • Dual binding sites: The crystal structures reveal two binding sites that are critical for the enzyme's function.

  • Essential residues: Site-directed mutagenesis and complementation studies have identified critical amino acid residues, including Arg143 and Arg239, which are essential for diacylglyceryl transfer activity .

  • Lateral substrate entry/exit: Structural and biochemical data support a mechanism whereby the substrate and lipid-modified lipobox-containing peptide product enter and leave the enzyme laterally relative to the lipid bilayer .

What methodologies are most effective for expressing and purifying recombinant Y. enterocolitica serotype O:8/biotype 1B lgt?

Based on established protocols for similar proteins, the following methodologies are recommended for expressing and purifying recombinant Y. enterocolitica lgt:

Expression System Selection:

  • E. coli expression systems (particularly BL21(DE3) or C41(DE3) strains) are often preferred for membrane proteins like Lgt

  • Expression vectors containing N-terminal or C-terminal affinity tags (His6, MBP, or GST) facilitate purification

  • Inducible promoters (T7 or arabinose-inducible) allow controlled expression

Optimization of Expression Conditions:

  • Lower induction temperatures (16-20°C) often improve folding of membrane proteins

  • Inducer concentration titration to determine optimal expression levels

  • Addition of membrane-stabilizing agents during expression

Membrane Fraction Isolation and Solubilization:

  • Cell disruption via sonication or French press

  • Differential centrifugation to isolate membrane fractions

  • Solubilization using appropriate detergents (DDM, LDAO, or Triton X-100)

Purification Strategy:

  • Affinity chromatography using the introduced tag

  • Size exclusion chromatography to remove aggregates

  • Ion exchange chromatography for further purification

Activity Validation:

  • In vitro enzymatic assay measuring glycerol phosphate release, which is a by-product of the Lgt-catalyzed transfer of diacylglyceryl from phosphatidylglycerol to a peptide substrate

  • Use of synthetic peptide substrates derived from known lipoproteins (e.g., Pal-IAAC, where C is the conserved cysteine modified by Lgt)

These methodologies should be optimized specifically for Y. enterocolitica serotype O:8/biotype 1B lgt to account for any unique properties of this particular enzyme variant.

How can the enzymatic activity of recombinant Y. enterocolitica lgt be measured in vitro?

The enzymatic activity of recombinant Y. enterocolitica lgt can be measured using several complementary approaches:

1. Glycerol Phosphate Release Assay:
This is the most direct method to measure Lgt activity in vitro. The assay quantifies glycerol phosphate, which is released as a by-product during the Lgt-catalyzed transfer of diacylglyceryl from phosphatidylglycerol to a peptide substrate .

Reaction Components:

  • Purified recombinant Lgt

  • Phosphatidylglycerol substrate

  • Synthetic peptide substrate (e.g., Pal-IAAC)

  • Appropriate buffer system

Detection Methods:

  • Colorimetric assays for glycerol phosphate

  • Coupled enzyme assays

  • Radioactive assays using labeled phosphatidylglycerol

2. Mass Spectrometry-Based Assay:
Mass spectrometry can be used to directly detect the formation of diacylglyceryl-modified peptide products, providing detailed structural information about the reaction products.

3. GFP-Based In Vitro Assay:
A GFP-based assay system has been successfully employed to correlate Lgt activities with structural observations . This approach involves:

  • Fusion of substrate peptides to GFP

  • Monitoring changes in GFP fluorescence properties upon lipid modification

  • Correlation with structural data from crystallography

4. Complementation Studies:
The functional activity of recombinant Lgt variants can be assessed through complementation of lgt-knockout cells. This approach has been used to identify residues critical for diacylglyceryl transfer, including Arg143 and Arg239 .

The selection of the appropriate assay depends on the specific research question, available equipment, and desired level of detail in measuring enzymatic activity.

What is the relationship between Y. enterocolitica lgt and autoimmune conditions such as Graves' disease?

Y. enterocolitica produces a lipoprotein (LP) that can cross-react with the thyrotropin receptor (TSHR), potentially triggering thyroid autoimmunity in Graves' disease. This molecular mimicry represents a significant mechanism by which bacterial infections might lead to autoimmune conditions .

Research has demonstrated several key aspects of this relationship:

  • Cross-reactivity: Mouse antibodies generated against recombinant Y. enterocolitica LP cross-react with TSHR, as demonstrated by western blot analysis .

  • Immunomodulatory effects: The recombinant LP has been shown to be mitogenic for C3H/HeJ (LPS hyporesponsive) B cells and induces production and secretion of significant levels of IL-6 from splenocytes .

  • Co-stimulatory molecule upregulation: FACS analysis of splenocytes from mice immunized with LP revealed that LP could induce increased expression of co-stimulatory molecules B7.1 and B7.2, which are critical for T cell activation .

  • Breakdown of self-tolerance: The combined immunomodulatory effects of LP, including upregulation of B7.1 and B7.2, coupled with its ability to induce antibodies that cross-react with TSHR, provide potential mechanisms by which it can cause breakdown of self-tolerance to TSHR .

These findings suggest that infection with Y. enterocolitica, particularly strains expressing these cross-reactive lipoproteins, may contribute to the development of autoimmune thyroid conditions in genetically susceptible individuals.

How does lgt contribute to the pathogenicity of Y. enterocolitica serotype O:8/biotype 1B?

The lgt enzyme plays a crucial role in the pathogenicity of Y. enterocolitica through several mechanisms:

  • Essential for bacterial survival: Lgt catalyzes the first step in lipoprotein biogenesis, which is vital for bacterial survival. Deletion of the lgt gene is lethal to most Gram-negative bacteria, including pathogenic Yersinia strains .

  • Outer membrane integrity: Lipoproteins modified by Lgt are essential for maintaining outer membrane integrity. Depletion of Lgt leads to permeabilization of the outer membrane, increasing susceptibility to environmental stresses and host immune defenses .

  • Virulence factor expression: Many virulence-associated proteins in Y. enterocolitica are lipoproteins that require proper processing by Lgt for their function.

  • Immune evasion: Properly processed lipoproteins can help the bacteria evade host immune responses, particularly in serotype O:8/biotype 1B strains, which are known for their enhanced virulence.

  • Adhesion and invasion properties: Lipoproteins contribute to the ability of Y. enterocolitica to adhere to and invade host cells, which is particularly significant for serotype O:8/biotype 1B strains.

  • Resistance to antimicrobial peptides: The lipid modifications added by Lgt contribute to bacterial resistance against host antimicrobial peptides, a key feature of virulent Yersinia strains.

Understanding the role of Lgt in pathogenicity has led to its identification as a potential target for novel antimicrobial therapies, as inhibition of this enzyme could significantly compromise bacterial survival and virulence .

What strategies can be employed to generate knockout or conditional mutants of lgt in Y. enterocolitica serotype O:8/biotype 1B?

1. Conditional Mutant Systems:

  • Arabinose-Inducible Promoter: Engineer Y. enterocolitica strains where the only copy of lgt is under control of an arabinose-inducible promoter (similar to the approach used in E. coli) . This allows for controlled expression and depletion of Lgt.

  • Temperature-Sensitive Promoters: Place lgt under the control of temperature-sensitive promoters that allow expression at permissive temperatures but repress at restrictive temperatures.

2. CRISPR-Cas9 Based Approaches:

  • Utilize CRISPR-Cas9 systems optimized for Y. enterocolitica to create precise mutations in lgt

  • Design guide RNAs targeting specific regions of the lgt gene

  • Include homology-directed repair templates for introducing specific mutations

3. Transposon Mutagenesis:

  • Screen transposon libraries for insertions that affect lgt expression but still allow minimal growth

  • Identify suppressors that allow survival despite reduced Lgt function

4. Complementation Systems:

  • Create a strain with an inducible extra copy of lgt

  • Delete or inactivate the chromosomal copy

  • Study the effects of various lgt mutations by expressing them from a plasmid

Important Considerations:

  • When designing conditional lgt mutants, confirm that thyA expression (the gene downstream of lgt) remains unchanged, as these genes may share transcriptional coupling

  • Monitor for suppressor mutations that might arise to compensate for reduced Lgt activity

  • Validate changes in lipoprotein processing using proteomic approaches

These strategies provide researchers with options to study Lgt function while accounting for its essential nature in bacterial viability.

What in vitro and in vivo models are most suitable for studying the function of Y. enterocolitica lgt in pathogenesis?

A combination of in vitro and in vivo models enables comprehensive study of Y. enterocolitica lgt's role in pathogenesis:

In Vitro Models:

  • Cell Culture Systems

    • Human intestinal epithelial cell lines (Caco-2, HT-29)

    • Macrophage cell lines (RAW264.7, THP-1)

    • Primary human or murine intestinal organoids

    These systems allow assessment of:

    • Bacterial adhesion and invasion capabilities

    • Host cell response to infection

    • Effects of lgt modulation on bacterial internalization

  • Membrane Permeability Assays

    • Measuring uptake of hydrophobic compounds (e.g., NPN, ANS)

    • Assessing sensitivity to antibiotics that typically cannot penetrate intact outer membranes

    • Tracking release of periplasmic enzymes

  • Serum Resistance Assays

    • Evaluate bacterial survival in normal human serum

    • Compare wild-type and lgt-depleted strains for resistance to complement-mediated killing

In Vivo Models:

  • Mouse Infection Models

    • Oral infection model (mimics natural route of infection)

    • Intraperitoneal infection (systemic spread model)

    • Specialized mouse models for studying:

      • Mesenteric lymphadenitis

      • Systemic infection

  • Gnotobiotic Piglet Model

    • More closely resembles human intestinal physiology

    • Useful for studying gastrointestinal pathogenesis

  • Drosophila melanogaster

    • Simple model for high-throughput screening

    • Useful for initial assessment of virulence factors

  • Galleria mellonella (Wax Moth) Larvae

    • Intermediate complexity invertebrate model

    • Maintains 37°C body temperature

    • Possesses innate immune functions similar to mammals

Parameters to Monitor:

Model TypeKey ParametersRelevance to lgt Function
Cell CultureAdhesion, invasion, cytokine productionAssess direct role of lgt-modified lipoproteins in host-pathogen interactions
Membrane AssaysPermeability changes, antibiotic sensitivityEvaluate structural roles of lipoproteins in membrane integrity
Serum AssaysSurvival rate, complement activationDetermine role in immune evasion
Mouse ModelsBacterial burden, histopathology, immune responseComprehensive assessment of virulence in vivo
Invertebrate ModelsSurvival, bacterial persistenceRapid screening of lgt variants

When designing these experiments, it's crucial to include appropriate controls, including complemented strains expressing wild-type lgt to confirm that observed phenotypes are specifically due to lgt disruption.

What approaches can be used to identify and develop inhibitors of Y. enterocolitica lgt as potential antibacterial agents?

Several strategic approaches can be employed to identify and develop inhibitors of Y. enterocolitica lgt:

1. Structure-Based Drug Design:

  • Utilize crystal structure information from homologous Lgt proteins (such as E. coli Lgt)

  • Perform in silico docking studies to identify compounds that may bind to the active site

  • Design molecules that can compete with natural substrates (phosphatidylglycerol or prolipoprotein)

  • Focus on targeting critical residues (e.g., Arg143, Arg239) identified through mutagenesis studies

2. High-Throughput Screening (HTS):

  • Develop and optimize biochemical assays measuring glycerol phosphate release

  • Screen diverse chemical libraries against purified recombinant Y. enterocolitica Lgt

  • Employ counterscreens to eliminate false positives and compounds with undesirable properties

  • Consider fragment-based screening approaches

3. Repurposing Existing Compounds:

  • Test known inhibitors of related enzymes or similar bacterial targets

  • Evaluate compounds with established safety profiles that could be repurposed

  • Screen approved drug libraries to identify potential hits

4. Phenotypic Screening:

  • Use conditional lgt mutants to identify compounds that specifically kill or inhibit growth when Lgt is depleted

  • Screen for compounds that increase outer membrane permeability in a manner similar to Lgt depletion

  • Identify synergistic combinations with existing antibiotics

5. Validation and Optimization Pipeline:

StageApproachKey Metrics
Primary ScreeningBiochemical assay measuring Lgt activityIC50 values
Secondary ValidationBacterial growth inhibitionMIC values
Mechanism ConfirmationAccumulation of unprocessed prolipoproteinsWestern blot analysis
Specificity AssessmentTesting against human enzymesSelectivity index
Lead OptimizationMedicinal chemistry modificationsImproved potency, reduced toxicity
In vivo EvaluationAnimal infection modelsEfficacy, pharmacokinetics

6. Resistance Development Assessment:
One significant advantage of targeting Lgt is that, unlike inhibitors of other steps in lipoprotein biosynthesis, deletion of the major outer membrane lipoprotein (lpp) is not sufficient to rescue growth after Lgt depletion or provide resistance to Lgt inhibitors . This suggests Lgt inhibitors may be less prone to this common resistance mechanism.

Recent research has validated Lgt as a novel druggable antibacterial target, with the first Lgt inhibitors showing potent activity against wild-type Acinetobacter baumannii and E. coli strains , suggesting similar approaches could be effective for Y. enterocolitica.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.