Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Protease HtpX (htpX)

Shipped with Ice Packs
In Stock

Description

Yersinia enterocolitica Serotype O:8 / Biotype 1B: Pathogenic Context

Yersinia enterocolitica is an aero-anaerobic Gram-negative coccobacilli belonging to the Enterobacteriaceae family. This bacterial species can be subdivided into six biotypes based on biochemical reactions, with significant variation in pathogenicity: biotype 1A is generally considered non-pathogenic, biotypes 2-5 demonstrate low pathogenicity, while biotype 1B exhibits high pathogenicity . The serotype O:8, particularly associated with biotype 1B, represents one of the most virulent forms of Y. enterocolitica, capable of causing severe systemic infections beyond the typical gastrointestinal manifestations associated with less virulent strains.

The pathogenic capacity of Y. enterocolitica biotype 1B is significantly enhanced by the presence of the Yersinia High-Pathogenicity Island (HPI), a genetic element encoding an iron uptake system mediated by the siderophore yersiniabactin (Ybt) . This system plays a critical role in bacterial virulence by facilitating iron acquisition in the iron-limited environment of the host organism. The HPI has been demonstrated to contribute substantially to the virulence of extraintestinal pathogenic Escherichia coli, suggesting its potential significance in the pathogenicity of Y. enterocolitica as well .

Clinical manifestations of Y. enterocolitica biotype 1B infections can range from self-limiting gastroenteritis to severe systemic infections, including mesenteric lymphadenitis, deep abscesses, septicemia, and rarely, osteoarticular infections . The first isolation of Y. enterocolitica serotype O:8 in Japan was reported in a 4-year-old boy, highlighting the potential for global distribution of this highly pathogenic strain .

Functional Properties and Biological Role

HtpX belongs to a family of proteases involved in protein quality control, particularly in response to stress conditions. Although specific research on the Y. enterocolitica HtpX is limited in the provided search results, insights can be drawn from homologous proteins in related bacterial species.

The designation "HtpX" (Heat shock protein X) suggests a role in the bacterial stress response, particularly in conditions of elevated temperature. As a membrane-bound protease, HtpX likely participates in the degradation or processing of misfolded or damaged membrane proteins, contributing to membrane integrity under stress conditions .

In the context of Y. enterocolitica pathogenicity, the role of proteases extends beyond basic cellular maintenance to active participation in virulence. For instance, the HreP protease in Y. enterocolitica, which demonstrates similarity to eukaryotic subtilisin/kexin-like proteases, has been shown to be essential for full virulence in mouse models of infection . While HreP and HtpX represent different protease families, this example illustrates the potential significance of proteolytic enzymes in bacterial pathogenicity.

Recombinant Expression and Purification

The recombinant HtpX protein from Y. enterocolitica serotype O:8 / biotype 1B can be successfully expressed in E. coli expression systems. The typical approach involves the use of a vector that incorporates an N-terminal His-tag, facilitating subsequent purification through affinity chromatography . The expressed protein is generally obtained in the form of a lyophilized powder with a purity exceeding 90%, as determined by SDS-PAGE analysis.

The technical specifications for the recombinant protein production and handling, as provided in the commercial product information, are summarized in the following table:

ParameterSpecification
Expression SystemE. coli
TagN-terminal His
Protein LengthFull Length (1-293 amino acids)
FormLyophilized powder
Purity>90% (by SDS-PAGE)
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Recommended Storage-20°C/-80°C
ReconstitutionDeionized sterile water (0.1-1.0 mg/mL)
Post-reconstitutionAddition of 5-50% glycerol for long-term storage

This standardized approach to recombinant protein production ensures consistency and reliability in downstream applications, including structural studies, functional assays, and development of diagnostic or therapeutic tools .

Virulence Mechanism Investigation

Given the established role of proteases in bacterial virulence, the HtpX protease may contribute to the pathogenicity of Y. enterocolitica biotype 1B. Investigation of its potential substrates and regulatory networks could reveal novel aspects of Yersinia pathogenesis. This approach is supported by previous studies on other Y. enterocolitica proteases, such as HreP, which has been shown to be necessary for full virulence .

Diagnostic and Therapeutic Development

The specificity of the HtpX protease to Y. enterocolitica serotype O:8 / biotype 1B suggests potential applications in diagnostic tools for identifying this highly pathogenic strain. Additionally, if the protease proves to be essential for bacterial survival or virulence, it could represent a target for novel antimicrobial agents.

Comparative Analysis with Other Bacterial Proteases

Understanding the HtpX protease in the context of other bacterial proteases provides valuable insights into its potential function and significance. The search results include information on several other proteases from Yersinia species that may serve as useful comparisons.

The HreP protease of Y. enterocolitica, for instance, is expressed specifically during infection but not under laboratory conditions, suggesting tight regulatory control that may be similar to that of HtpX . HreP is regulated by a network of three proteins (PypA, PypB, and PypC) that control its transcription. This regulatory network represents a potential model for understanding the regulation of other virulence-associated proteases, including HtpX .

Another relevant protease is HurP, a site 2 protease from bacteria that functionally modifies HurR, a sigma factor regulator essential for heme-dependent gene induction . This example illustrates how bacterial proteases can participate in complex regulatory networks controlling cellular responses to environmental signals, a function that might also be relevant to HtpX.

Future Research Directions

Based on the available information and the gaps in current knowledge, several directions for future research on the Y. enterocolitica HtpX protease can be identified:

  1. Determination of the specific substrates of HtpX in Y. enterocolitica and the consequences of their proteolytic processing.

  2. Investigation of the regulatory mechanisms controlling htpX expression, particularly in response to host environmental conditions.

  3. Assessment of the contribution of HtpX to bacterial survival under stress conditions relevant to the host environment, such as antimicrobial peptides, oxidative stress, or nutrient limitation.

  4. Evaluation of the potential of HtpX as a target for novel antimicrobial strategies, including the development of specific inhibitors.

  5. Comparative analysis of HtpX across different Yersinia species and strains to understand its evolution and specificity to the highly pathogenic biotype 1B.

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. If you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please notify us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize the development of your specified tag.
Synonyms
htpX; YE1869; Protease HtpX; Heat shock protein HtpX
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-293
Protein Length
full length protein
Species
Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Target Names
htpX
Target Protein Sequence
MMRIALFLLTNLAVMLVFGLVLSLTGIQSSSVQGLMIMAGLFGFGGAFVSLLMSKWMALR SVGGEVIEQPRNETERWLLDTVRRQSQQAGIAMPQVAIYQAPDINAFATGARRDASLVAV STGLLQNMSRDEAEAVIAHEISHVANGDMVTMTLIQGIVNTFVIFISRLIAQVAAGFLSG DRDNEGSSSGNPMVYFAVSMVLELVFGILASIITMWFSRHREFHADAGSARLVGREKMIA ALQRLKTSYEPQEAGNLMAFCINGKSKSFSELFMSHPPLDKRIEALRSGEYLK
Uniprot No.

Target Background

Database Links

KEGG: yen:YE1869

STRING: 393305.YE1869

Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is HtpX and what is its function in Yersinia enterocolitica?

HtpX in Yersinia enterocolitica is a membrane-bound zinc metalloproteinase belonging to the M48 family of proteases. Similar to its homolog in Escherichia coli, HtpX is believed to function primarily in the quality control of membrane proteins, degrading misfolded or damaged membrane proteins that could potentially compromise bacterial membrane integrity . In Y. enterocolitica, this protease is thought to play a critical role in cellular homeostasis, particularly under stress conditions when proteins may become denatured or misfolded.

The protein contains four hydrophobic regions (H1-H4) that likely serve as transmembrane segments, anchoring the protein in the cytoplasmic membrane with its catalytic domain positioned to access substrate proteins . The zinc-binding motif HEXXH in HtpX is essential for its proteolytic activity, coordinating a zinc ion that facilitates peptide bond hydrolysis.

How does HtpX expression respond to environmental stresses in Y. enterocolitica?

HtpX expression in Y. enterocolitica appears to be regulated in response to various environmental stresses, particularly those that affect protein folding in the membrane compartment. While specific regulation of HtpX in Y. enterocolitica has not been extensively characterized, insights from related systems suggest that expression likely increases under conditions that promote protein misfolding, such as elevated temperatures, oxidative stress, and exposure to antimicrobial compounds.

Drawing parallels from E. coli systems, HtpX expression may be controlled by stress-response mechanisms that sense envelope stress, potentially involving a two-component regulatory system similar to CpxRA, which has been shown to regulate stress responses in Y. enterocolitica . Under normal growth conditions, expression levels of HtpX remain relatively low, but increase substantially when cells encounter conditions that compromise protein folding and membrane integrity.

What are the structural characteristics of HtpX in Y. enterocolitica?

The HtpX protease in Y. enterocolitica shares structural similarities with other M48 family zinc metalloproteinases. Structurally, the protein is characterized by:

  • Four hydrophobic regions (H1-H4) that function as transmembrane domains, embedding the protein in the cytoplasmic membrane

  • A zinc-binding motif (HEXXH) in its catalytic domain that coordinates a zinc ion essential for proteolytic activity

  • Conserved glutamate residues that participate in the catalytic mechanism of peptide bond hydrolysis

  • A topology that positions the catalytic domain to access substrate proteins in either the cytoplasm or within the membrane bilayer

The tertiary structure of HtpX facilitates its function in recognizing and cleaving misfolded membrane proteins, with its active site positioned optimally for accessing substrate proteins in their membrane environment. The precise arrangement of the transmembrane segments remains somewhat controversial, particularly regarding whether all four hydrophobic regions fully traverse the membrane .

What assay systems can be employed to measure HtpX proteolytic activity in Y. enterocolitica?

Researchers studying HtpX proteolytic activity in Y. enterocolitica can adapt several approaches based on established methodologies for related proteases:

  • In vivo model substrate assay: A system similar to that developed for E. coli HtpX can be employed, utilizing engineered fusion proteins as model substrates . This approach involves:

    • Constructing fusion proteins containing potential cleavage sites flanked by detectable tags (e.g., GFP or epitope tags)

    • Expressing these substrates in Y. enterocolitica strains with varying HtpX expression levels

    • Analyzing proteolytic processing via Western blotting or fluorescence-based detection

  • In vitro reconstitution assay:

    • Purifying recombinant HtpX with intact transmembrane domains using detergent solubilization

    • Incorporating the purified protein into proteoliposomes or nanodiscs

    • Measuring proteolytic activity against purified substrate proteins using mass spectrometry or SDS-PAGE analysis

  • Proteomics-based substrate identification:

    • Comparing membrane proteome profiles between wild-type and htpX-deficient Y. enterocolitica using quantitative proteomics

    • Identifying proteins that accumulate in the absence of HtpX activity

    • Validating potential substrates through targeted expression and degradation assays

These methodologies should incorporate appropriate controls, including catalytically inactive HtpX variants carrying mutations in the zinc-binding motif, to distinguish specific proteolytic events from general protein turnover.

How can researchers generate and characterize htpX mutants in Y. enterocolitica?

The generation and characterization of htpX mutants in Y. enterocolitica requires specialized techniques to ensure precise genetic manipulation while maintaining bacterial viability. The following methodological approach is recommended:

  • Mutant generation:

    • Allelic exchange using suicide vectors (e.g., pKNG101 derivatives) carrying either deletion constructs or site-directed mutations

    • CRISPR-Cas9 based genome editing using customized guide RNAs targeting the htpX locus

    • Transposon mutagenesis followed by screening for insertions in htpX

  • Verification of mutations:

    • PCR amplification and sequencing of the modified htpX locus

    • Quantitative RT-PCR to confirm transcriptional changes

    • Western blot analysis using anti-HtpX antibodies to verify protein expression alterations

  • Phenotypic characterization:

    • Growth curve analysis under various stress conditions (temperature, pH, oxidative stress)

    • Membrane protein profile analysis using 2D gel electrophoresis

    • Electron microscopy to assess membrane integrity and cell morphology

    • Virulence assessment in cellular and animal infection models

  • Complementation studies:

    • Expression of wild-type htpX from controlled promoters on plasmids

    • Site-specific chromosomal restoration of htpX

    • Cross-complementation with htpX homologs from related species to assess functional conservation

This comprehensive approach enables researchers to establish causal relationships between specific HtpX functions and observed phenotypes in Y. enterocolitica.

What are the recommended protocols for purification of recombinant HtpX from Y. enterocolitica?

Purification of membrane-bound HtpX presents significant technical challenges that require specialized approaches:

  • Expression system optimization:

    • Heterologous expression in E. coli using membrane protein-optimized strains (C41/C43)

    • Homologous expression in Y. enterocolitica using controlled induction systems

    • Fusion with solubility-enhancing tags (e.g., MBP) for improved expression

  • Solubilization and extraction:

    • Membrane fraction isolation using differential centrifugation

    • Careful selection of detergents (n-dodecyl-β-D-maltoside, digitonin, or CHAPSO) for efficient solubilization while preserving activity

    • Optimization of detergent:protein ratios to prevent aggregation

  • Purification strategy:

    • Metal affinity chromatography using engineered His-tags (preferably C-terminal to avoid interference with membrane insertion)

    • Size exclusion chromatography to remove aggregates and achieve homogeneity

    • Ion exchange chromatography as a polishing step

  • Activity preservation:

    • Incorporation of zinc in buffers to maintain metalloprotease activity

    • Addition of glycerol (10-20%) to stabilize the protein structure

    • Careful pH control to optimize stability (typically pH 7.5-8.0)

Table 1 summarizes the recommended detergents and their properties for HtpX purification:

DetergentCritical Micelle Concentration (mM)AdvantagesDisadvantages
DDM0.17Mild, preserves activityLarger micelles
CHAPSO8.0Compatible with functional assaysLess efficient extraction
Digitonin0.5Excellent for structural studiesExpensive, variable purity
LMNG0.01High stability, small micellesStrong UV absorption

How does HtpX interact with other protein quality control systems in Y. enterocolitica?

HtpX functions within a complex network of protein quality control systems in Y. enterocolitica. Current research suggests several key interactions:

  • Complementary function with HtrA: While HtpX targets misfolded proteins in the membrane, HtrA (DegP) addresses misfolded proteins in the periplasm . These systems may have overlapping functions, with evidence suggesting that HtrA is important for intracellular survival and virulence in Y. enterocolitica .

  • Integration with the CpxRA two-component system: The CpxRA system, known to regulate envelope stress responses in Y. enterocolitica, likely influences HtpX expression . The relationship appears to differ from that in E. coli, as distinctive stimuli activate these pathways in Y. enterocolitica.

  • Coordination with other proteases: HtpX likely functions in coordination with other proteases, including cytoplasmic proteases like Lon and ClpP, to ensure comprehensive protein quality control throughout the cell.

  • Potential interaction with chaperone systems: Molecular chaperones such as DnaK/DnaJ and GroEL/GroES may work cooperatively with HtpX by attempting to refold proteins before they are targeted for degradation.

The exact hierarchical relationship and regulatory cross-talk between these systems in Y. enterocolitica remains an active area of research, with evidence suggesting both redundancy and specificity in their functions.

What is the significance of HtpX in Y. enterocolitica virulence and host interaction?

The role of HtpX in Y. enterocolitica virulence appears multifaceted, though not as extensively characterized as other virulence factors:

  • Stress adaptation during infection: HtpX likely contributes to bacterial survival during infection by maintaining membrane protein homeostasis under host-imposed stresses, including temperature shifts, oxidative stress, and antimicrobial peptide exposure.

  • Indirect effects on virulence factor expression: By ensuring proper membrane protein quality control, HtpX may indirectly influence the functionality of membrane-associated virulence factors, including adhesins, invasins, and secretion systems.

  • Potential role in host immune evasion: Though speculative, proper membrane protein quality control facilitated by HtpX may help maintain outer membrane integrity, potentially reducing the release of immunostimulatory bacterial components that could trigger host immune responses.

  • Contribution to intracellular survival: Drawing parallels with HtrA, which is important for intracellular survival of Y. enterocolitica , HtpX may similarly contribute to bacterial persistence within host cells by managing protein damage resulting from the hostile intracellular environment.

Interestingly, while CpxR mutant strains of Y. enterocolitica were not impaired for virulence in mouse models , the specific contribution of HtpX to virulence remains to be fully elucidated and may depend on specific infection contexts and bacterial strains.

How do structural variations in HtpX across different Y. enterocolitica strains affect function?

Comparative analysis of HtpX across Y. enterocolitica strains reveals structural variations that may impact functional properties:

  • Transmembrane domain variations: Subtle differences in the hydrophobic regions may affect membrane insertion and topology, potentially influencing substrate accessibility and specificity.

  • Catalytic domain polymorphisms: Amino acid substitutions near the zinc-binding motif may modulate catalytic efficiency and substrate preference without completely abolishing activity.

  • Strain-specific expression patterns: Variations in promoter regions and regulatory elements can lead to differential expression of HtpX across strains, affecting the protease's availability during stress responses.

  • Variations in C-terminal regions: The C-terminal domain, which may be involved in substrate recognition, shows greater variability across strains, potentially contributing to strain-specific substrate preferences.

These structural variations may contribute to the adaptability of different Y. enterocolitica strains to diverse environmental niches and hosts. Researchers should consider these variations when extrapolating findings from one strain to another, particularly when comparing highly pathogenic biotype 1B strains with less virulent biotypes.

What are common challenges in expressing recombinant HtpX and how can they be addressed?

Researchers frequently encounter specific challenges when working with recombinant HtpX:

  • Low expression levels:

    • Solution: Optimize codon usage for the expression host

    • Solution: Test different promoter strengths and induction conditions

    • Solution: Use specialized strains designed for membrane protein expression (C41/C43)

  • Protein aggregation and inclusion body formation:

    • Solution: Lower induction temperature (16-20°C)

    • Solution: Reduce inducer concentration

    • Solution: Express as fusion with solubility enhancers (MBP, SUMO)

  • Toxicity to expression host:

    • Solution: Use tightly controlled inducible systems

    • Solution: Express in strains with higher tolerance to membrane protein overexpression

    • Solution: Consider cell-free expression systems for highly toxic constructs

  • Loss of proteolytic activity:

    • Solution: Ensure proper incorporation of zinc in purification buffers

    • Solution: Optimize detergent selection to maintain native-like membrane environment

    • Solution: Consider nanodiscs or proteoliposomes for activity assays

Table 2 summarizes expression optimization strategies and their outcomes:

ChallengeOptimization StrategyExpected OutcomeSuccess Indicators
Low expressionLower temperature (16°C)Slower expression, better foldingIncreased soluble fraction
AggregationFusion with MBPEnhanced solubilityReduced aggregation on SEC
ToxicityC41/C43 expression strainsTolerance to membrane proteinHigher cell density, better growth curve
Activity lossNanodisc reconstitutionNative-like environmentRestored proteolytic activity

How can researchers differentiate between direct and indirect effects of htpX mutation in phenotypic studies?

Distinguishing direct from indirect effects of htpX mutation requires rigorous experimental design:

  • Complementation analysis:

    • Wild-type complementation: Restoration of the wild-type phenotype with htpX expression confirms direct causality

    • Catalytic mutant complementation: Expression of catalytically inactive HtpX can distinguish structural from enzymatic roles

  • Substrate-specific approaches:

    • Direct substrate validation: Demonstrate direct proteolytic processing of candidate substrates by purified HtpX in vitro

    • Accumulation kinetics: Monitor the time course of substrate accumulation following htpX inactivation

  • Suppressor analysis:

    • Identify secondary mutations that suppress htpX phenotypes, revealing potential bypass pathways

    • Characterize these suppressors to map the functional network around HtpX

  • System-level control experiments:

    • Compare htpX phenotypes with those of other proteases to identify shared versus specific effects

    • Use global approaches (transcriptomics, proteomics) to distinguish primary from secondary responses

This methodical approach helps researchers avoid misattributing phenotypes to direct HtpX activity when they may result from broader cellular adaptations to protease deficiency.

What controls should be included in HtpX activity assays to ensure reliable results?

Robust experimental design for HtpX activity assays requires several critical controls:

  • Negative controls:

    • Catalytically inactive HtpX mutant (H->A substitution in HEXXH motif)

    • Assay conducted in the presence of metalloprotease inhibitors (e.g., EDTA, 1,10-phenanthroline)

    • Substrate alone without HtpX addition

  • Positive controls:

    • Known metalloprotease with well-characterized activity

    • E. coli HtpX (if available) as a reference standard

    • Time course analysis to demonstrate progressive substrate processing

  • Specificity controls:

    • Non-substrate proteins to demonstrate selective degradation

    • Varying substrate concentrations to assess enzyme kinetics

    • Competition assays with known and putative substrates

  • System validation:

    • In vivo correlation between in vitro observations and cellular phenotypes

    • Demonstration of zinc dependency through metal chelation and restitution

    • Comparison of wild-type Y. enterocolitica with htpX knockout strains

Table 3 outlines the essential controls for different HtpX activity assay formats:

Assay TypeEssential ControlPurposeExpected Result
In vitro proteolysisEDTA treatmentConfirm metal dependencyComplete inhibition
In vivo substrate processingCatalytic mutant expressionDistinguish proteolysis from other effectsNo substrate cleavage
Membrane protein degradationCytoplasmic proteinConfirm compartment specificityNo degradation of cytoplasmic control
Kinetic analysisMultiple time pointsEstablish progression of activityLinear initial rate

How might HtpX function differ between Y. enterocolitica and other bacterial species?

Comparative analysis suggests potential differences in HtpX function across bacterial species:

  • Regulatory network integration: In Y. enterocolitica, regulation of stress response proteases appears to differ from E. coli, with distinctive stimuli activating similar pathways . For example, while overproduction of outer membrane proteins induces HtrA expression via RpoE in E. coli, in Y. enterocolitica it occurs via the Cpx system .

  • Substrate specificity: The substrate profile of HtpX likely varies between species due to differences in membrane proteome composition and specific adaptations to environmental niches.

  • Functional redundancy: The degree of functional overlap with other proteases may differ in Y. enterocolitica compared to other species, potentially reflecting adaptation to different stress conditions encountered during infection.

  • Contribution to virulence: The importance of HtpX for virulence may vary across pathogens, with potentially greater significance in bacteria that face particular membrane protein folding challenges during host infection.

These differences highlight the importance of species-specific research rather than simple extrapolation from model organisms like E. coli, particularly when considering therapeutic targeting of these systems.

What novel techniques are emerging for studying membrane protease dynamics in Y. enterocolitica?

Several cutting-edge approaches are advancing our understanding of membrane protease dynamics:

  • Cryo-electron microscopy: Enabling visualization of HtpX structure in near-native membrane environments, providing insights into substrate interaction mechanisms and conformational changes during catalysis.

  • Single-molecule fluorescence microscopy: Allowing real-time tracking of HtpX localization and mobility in living bacteria, revealing potential compartmentalization and clustering during stress responses.

  • Proximity-dependent biotin labeling (BioID or APEX2): Identifying proteins in close proximity to HtpX in vivo, mapping the interactome of the protease within the membrane environment.

  • Quantitative degradomics: Using mass spectrometry approaches to identify the complete set of proteins whose stability depends on HtpX, providing a comprehensive view of its substrate landscape.

  • Genetic interaction mapping: Systematic analysis of genetic interactions between htpX and other genes through techniques like CRISPRi screening, revealing functional relationships within cellular networks.

These approaches, when applied to Y. enterocolitica, promise to reveal new dimensions of HtpX function in membrane protein quality control and stress adaptation.

How might understanding HtpX function contribute to new antimicrobial strategies against Y. enterocolitica?

Research into HtpX function could inform novel antimicrobial approaches:

  • Direct inhibition strategy: Development of specific inhibitors targeting the unique catalytic features of HtpX, potentially disrupting membrane protein homeostasis and sensitizing bacteria to host defenses.

  • Stress sensitization approach: Combining HtpX inhibition with treatments that cause membrane protein misfolding, creating synergistic effects that overwhelm bacterial stress response capacity.

  • Attenuated vaccine development: Engineering Y. enterocolitica strains with modified htpX genes that maintain immunogenicity while reducing virulence, potentially serving as live attenuated vaccine candidates.

  • Host response modulation: Understanding how HtpX activity influences host-pathogen interactions could reveal opportunities to enhance host defense mechanisms specifically effective against Y. enterocolitica infection.

  • Biofilm disruption: If HtpX contributes to biofilm formation or maintenance, as suggested by research on related proteins in other species , targeting this protease could provide strategies for disrupting persistent bacterial communities.

While commercial development remains distant, fundamental research into HtpX function provides essential groundwork for these potential therapeutic applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.