Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Rhomboid protease glpG (glpG)

Shipped with Ice Packs
In Stock

Description

Definition and Classification

Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Rhomboid protease glpG (glpG) is an intramembrane serine protease derived from the bacterial pathogen Yersinia enterocolitica strain 8081. This enzyme belongs to the rhomboid protease family, a group of membrane-integrated enzymes that catalyze hydrolysis of peptide bonds within transmembrane domains of protein substrates . The recombinant form is produced through heterologous expression systems, typically in E. coli, enabling detailed biochemical and structural characterization for research purposes .

Biological Significance

The biological importance of this protease stems from its unusual ability to perform proteolysis within the hydrophobic environment of cellular membranes. Rhomboid proteases like glpG are evolutionarily conserved across diverse organisms and play critical roles in various cellular processes . While Y. enterocolitica serotype O:3 has emerged as the predominant cause of human yersiniosis in recent decades, the serotype O:8 strain has been extensively studied as a model system for Yersinia pathogenicity . The recombinant glpG from this strain provides valuable insights into membrane protein processing mechanisms in bacterial pathogens.

Catalytic Mechanism

The catalytic mechanism of Y. enterocolitica rhomboid protease glpG involves several discrete steps typical of serine proteases but adapted to the membrane environment. Based on studies of related rhomboid proteases, the reaction proceeds through:

  1. Formation of a tetrahedral transition state when the catalytic serine attacks the carbonyl carbon of the substrate peptide bond

  2. Collapse of this intermediate, releasing the N-terminal portion of the substrate

  3. Hydrolysis of the resulting acyl-enzyme intermediate by a water molecule

  4. Release of the C-terminal portion and regeneration of the free enzyme

Crystal structures of rhomboid proteases in complex with inhibitors like diisopropyl fluorophosphonate (DFP) have provided critical insights into this mechanism, particularly regarding the formation and stabilization of the tetrahedral transition state during catalysis .

Active Site Interactions

A distinctive feature of rhomboid proteases is the relatively weak interaction energies among active site residues. Studies on E. coli GlpG, which shares significant homology with Y. enterocolitica glpG, have demonstrated that the hydrogen bonding network in the active site is characterized by weak coupling energies . Specifically, the interaction energy between the catalytic histidine and serine (His254 and Ser201) is approximately -1.4 kcal/mol, while the interaction between Ser201 and Asn154 is even weaker at about -0.2 kcal/mol .

Substrate Specificity and Recognition

Rhomboid proteases demonstrate an unusual dual capability for cleaving substrates not only within transmembrane domains but also in juxtamembrane regions . This versatility expands their potential substrate range and biological functions. While the specific substrates of Y. enterocolitica glpG remain to be fully characterized, studies on related rhomboid proteases suggest that structural features rather than strict sequence motifs determine substrate recognition.

The substrate specificity may be influenced by the unusual conformation observed in some crystal structures, where transmembrane segment S5 adopts a heavily tilted orientation, creating a lateral opening that may allow substrate access to the active site .

Research Applications

Recombinant Y. enterocolitica serotype O:8 / biotype 1B Rhomboid protease glpG serves as a valuable tool for fundamental research into membrane protein structure and function. The recombinant protein enables:

  1. Structural studies through crystallography and other biophysical techniques

  2. Enzyme kinetic analyses to understand catalytic mechanisms

  3. Protein-protein interaction studies to identify binding partners and substrates

  4. Development and testing of inhibitors as research tools or potential therapeutic agents

These applications contribute to our understanding of intramembrane proteolysis, a critical process in various biological systems with implications for both basic science and medicine.

Context of Y. enterocolitica as a Pathogen

Understanding the function of rhomboid protease glpG requires consideration of its bacterial source. Y. enterocolitica is a significant human pathogen that causes various gastrointestinal disorders. While serotype O:3 has emerged as the predominant cause of human yersiniosis in Europe and Japan (80-90% of cases), serotype O:8 strains like the one from which this recombinant protein is derived have been extensively studied as models for understanding Yersinia pathogenicity .

Y. enterocolitica serotype O:8, biotype 1B strains (including strain 8081) are highly virulent in mouse models and possess numerous virulence factors that enable them to colonize host tissues, evade immune responses, and cause disease .

Potential Contributions to Virulence

While the specific role of glpG in Y. enterocolitica pathogenicity has not been fully elucidated, studies on rhomboid proteases in other bacteria suggest potential involvement in virulence-associated processes, including:

  1. Processing of membrane-embedded adhesins or invasins

  2. Modulation of cell envelope properties affecting antibiotic resistance

  3. Regulation of quorum sensing and biofilm formation

  4. Processing of other virulence factors

The expression patterns and virulence mechanisms differ significantly between Y. enterocolitica serotypes O:3 and O:8, reflecting their adaptation to different hosts and environmental conditions . These differences may extend to the regulation and function of the rhomboid protease glpG, potentially contributing to the distinct pathogenicity profiles of these serotypes.

Therapeutic Potential

The recombinant Y. enterocolitica rhomboid protease glpG has potential applications in therapeutic development:

  1. As a target for novel anti-virulence compounds that could attenuate bacterial pathogenicity without killing the bacteria, potentially reducing selective pressure for resistance

  2. For screening chemical libraries to identify specific inhibitors

  3. As an antigen for vaccine development or diagnostic applications

The unusual resistance of rhomboid proteases to most conventional serine protease inhibitors presents both a challenge and an opportunity for developing specific inhibitors . 3,4-Dichloroisocoumarin (DCI) has demonstrated consistent inhibitory effects against multiple rhomboid proteases and could serve as a lead compound for therapeutic development .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them during order placement, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please communicate with us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can serve as a reference for your own preparations.
Shelf Life
The shelf life depends on various factors including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us and we will prioritize developing it according to your specifications.
Synonyms
glpG; YE3988; Rhomboid protease GlpG; Intramembrane serine protease
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-278
Protein Length
full length protein
Species
Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Target Names
glpG
Target Protein Sequence
MVRVIAISNLRLAQAFVDYMATRHVALEVKPDSQGAEIWLTDDEQLPQVQHELEQFLLDP LNPRYQAASWQSGNLHSNLPYQRFSYLQTLRSQAGPLTLSVMVLCIAIYILMQIVGDGAV MSWLAWPRDNSQYLQIWRWVSHAFLHFSLLHILFNLMWWWYLAGQMEKRLGTGKLLVLTI VSALFSGWGQSLFSGVNFGGLSGVVYALMGYVWLTGERAPERGISLPRGLMAFSVLWLVA GYFDILGLSIANAAHVSGLIIGLLMAFWDTRNSAKTTQ
Uniprot No.

Target Background

Function
Rhomboid-type serine protease that catalyzes intramembrane proteolysis.
Database Links

KEGG: yen:YE3988

STRING: 393305.YE3988

Protein Families
Peptidase S54 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What distinguishes Y. enterocolitica serotype O:8/biotype 1B from other serotypes in experimental models?

Y. enterocolitica serotype O:8/biotype 1B strains are characterized by unique virulence properties that distinguish them from other serotypes. These strains typically possess a complete set of virulence genes including ail, ystA, yadA, and virF, along with the Yersinia high pathogenicity island . Experimental studies have demonstrated that O:8/biotype 1B strains exhibit higher pathogenicity compared to other biotypes.

Unlike non-pathogenic O:8 strains that lack the major virulence genes, pathogenic O:8/biotype 1B strains contain the complete virulence plasmid pYV that encodes multiple virulence factors . When studying these organisms in research settings, it's essential to confirm their virulence profile through PCR detection of these markers.

For laboratory studies, researchers should note that Chinese isolates of O:8 strains typically lack the virulence determinants and belong to biotype 1A, making them potentially useful as control strains in comparative experiments with pathogenic biotype 1B strains .

How is the rhomboid protease GlpG structurally characterized within the membrane?

GlpG is an intramembrane serine protease with a unique architecture that allows for peptide bond hydrolysis within the normally hydrophobic membrane environment. Structural studies have revealed:

  • A catalytic serine recessed into the plane of the membrane within a hydrophilic cavity

  • The cavity opens to the extracellular face but is protected laterally from membrane lipids by transmembrane segments

  • Six transmembrane helices (TM1-6) with TM5 functioning as a lateral gate for substrate entry

  • A water-filled catalytic cavity that accommodates the hydrolysis reaction

Solid-state NMR spectroscopy studies of enzymatically active GlpG in native-like lipid environments have identified a previously unobserved kink in the central part of the gating helix TM5 and a dynamic hotspot at the N-terminal part of TM5 and the adjacent loop L4, indicating this region's importance for substrate gating .

What are the optimal methods for recombinant expression of Y. enterocolitica GlpG for structural and functional studies?

For recombinant expression of Y. enterocolitica GlpG, several methodologies have proven effective:

Expression System Selection:

  • E. coli BL21(DE3) strains are most commonly used for rhomboid protease expression

  • Expression vectors like pET-based systems (such as pET-30 Ek/LIC used for Yop proteins) offer controlled expression

Purification Strategy:

  • Express GlpG as fusion proteins (GST-GlpG or His-tagged variants)

  • Solubilize from isolated membranes using 1% dodecyl-β-d-maltoside

  • Purify through affinity chromatography (glutathione-Sepharose for GST fusions or immobilized metal affinity for His-tagged proteins)

  • Optional: Remove fusion tags using site-specific proteases (thrombin) if needed for functional studies

For accurate functional assessment, it's crucial to standardize protein yields through Coomassie staining after SDS/PAGE and quantify using infrared scanning methods .

How can researchers assess the enzymatic activity of recombinant GlpG in vitro?

In vitro assessment of GlpG enzymatic activity requires:

Substrate Selection:
Pure transmembrane substrates are optimal. C100Spitz-Flag, which contains the Spitz substrate motif recognized by rhomboid proteases, has been successfully used for in vitro studies of GlpG activity .

Assay Conditions:

  • Buffer: 50 mM Tris (pH 7.5), 150 mM NaCl, 0.1% dodecyl-β-d-maltoside

  • Temperature: 37°C

  • Incubation time: 1 hour

  • Detection method: Anti-Flag Western blot analysis

Activity Quantification:
Cleavage activity is assessed by measuring the appearance of cleavage products via Western blot or mass spectrometry. Mass spectrometry analysis has revealed that GlpG can cleave at multiple positions within the Spitz substrate motif, specifically between alanine-serine and glycine-alanine residues four and six residues into the transmembrane domain .

What is the current understanding of the substrate gating mechanism in GlpG rhomboid protease?

Two competing models for substrate gating in GlpG have been proposed based on structural studies:

L1 Loop Gating Model:
Initially, the L1 loop was proposed to function as a dynamic gate controlling substrate access.

Transmembrane Helix 5 (TM5) Lateral Displacement Model:
Current evidence supports TM5 movement as the primary gating mechanism:

  • Structure-function analyses using over 40 engineered GlpG variants show that mutations promoting TM5 displacement from the protease core enhanced enzyme activity 4-10 fold

  • The L1 loop appears to play a structural rather than dynamic gating role

  • Tethering TM5 to TM2 abolishes enzyme activity

  • Mutations affecting contacts between TM2 and TM5 in the membrane's middle region result in 7-fold stimulation of activity

Solid-state NMR spectroscopy has provided further evidence for this model, revealing conformational exchange between open and closed states for TM5 .

The current consensus model suggests that lateral displacement of TM5 away from the protease core is the rate-limiting step for substrate access to the internal active site.

How does membrane composition affect GlpG activity, and what methods can be used to study these effects?

Membrane composition significantly impacts GlpG activity due to its intramembrane nature. To study these effects:

Methodological Approaches:

  • Reconstitution in artificial membranes with defined lipid compositions

  • Solid-state NMR spectroscopy in native-like lipid environments

  • In vitro assays comparing activity in different detergent or lipid environments

Key Findings:

  • GlpG can release RhoA from artificial PE or PE/PIP2 vesicles, indicating that membrane composition affects substrate accessibility

  • Conformational dynamics of the gating helix TM5 are influenced by the surrounding lipid environment

  • Water molecules within the catalytic cavity, confirmed by proton-detected NMR experiments, are essential for the hydrolysis reaction

For experimental design, researchers should consider that detergent micelles may not perfectly recapitulate the lateral pressure applied by native membranes, potentially affecting observed gating mechanisms.

What mutagenesis strategies have been most informative for understanding GlpG function?

Structure-guided mutagenesis approaches have been particularly valuable for understanding GlpG function, with these specific strategies yielding significant insights:

1. Transmembrane Domain Mutations:

  • Mutating contacts between helices 2 and 5 in the middle region of the membrane resulted in dramatic 7-fold stimulation of activity

  • Mutations affecting the bottom of helix 5 hindered activity, indicating this region must remain stationary

2. Loop Interaction Disruption:

  • Mutations affecting L1 loop interactions strongly decreased enzyme activity, contradicting its proposed role as a dynamic gate

3. Cysteine-Substitution:

  • Introduction of cysteine residues allowed for disulfide cross-linking experiments that assessed the importance of helix flexibility

  • Tethering helix 5 to helix 2 through disulfide bonds abrogated enzyme activity

A systematic approach testing multiple positions throughout the protein has proven most effective, with mutations in TM2, TM4, TM5, TM6, and loops L1 and L5 providing complementary insights into the substrate gating mechanism.

What visualization techniques can be used to monitor Y. enterocolitica GlpG expression and localization in bacterial and host cells?

Several advanced visualization techniques have been employed to study Y. enterocolitica protein expression and localization:

Fluorescent Protein Fusions:

  • GFP fusion proteins allow monitoring of expression and localization both in vitro and in vivo

  • For Y. enterocolitica studies, truncated genes fused to gfp have been successfully used to study gene expression and protein translocation in cell culture and mouse infection models

Microscopy Approaches:

  • Confocal microscopy: For high-resolution imaging of bacterial proteins in fixed or living cells

  • Flow cytometry: For quantitative assessment of expression levels across bacterial populations

  • Immunofluorescence: Using specific antibodies to detect native proteins

In vivo Tracking:
Y. enterocolitica strains expressing fluorescent proteins can be visualized in infected tissues including peritoneum, spleen, liver, and Peyer's patches following infection of model organisms .

When designing GFP fusion constructs, care must be taken to ensure the fusion doesn't interfere with membrane insertion or proteolytic activity of GlpG.

How does GlpG contribute to Y. enterocolitica virulence and host-pathogen interactions?

While the specific role of GlpG in Y. enterocolitica virulence has not been fully characterized in the provided literature, research on rhomboid proteases in other bacterial pathogens suggests potential roles:

  • Protein processing: GlpG may be involved in processing of virulence factors or membrane proteins essential for pathogen survival and host interaction

  • Regulatory functions: Rhomboid proteases can regulate signaling events by releasing membrane-anchored factors

  • Stress response: GlpG might participate in membrane protein quality control during infection

To investigate GlpG's contribution to virulence, researchers could employ:

  • Targeted gene deletion or mutation of glpG

  • Assessment of mutant strains in infection models

  • Identification of GlpG substrates in Y. enterocolitica

The role of other Y. enterocolitica proteins in pathogenesis has been better characterized. For example, YopT leads to disruption of the actin cytoskeleton by modifying host Rho GTPases, contributing to evasion of phagocytosis . Understanding the interplay between GlpG and these established virulence factors represents an important research direction.

What approaches are effective for studying the immunological responses to Y. enterocolitica proteins, including potential GlpG interactions?

Several approaches have proven effective for studying immune responses to Y. enterocolitica proteins:

T Cell Response Analysis:

  • Isolation of T cell clones from patients with Y. enterocolitica infections

  • Assessment of proliferative responses to bacterial antigens presented by autologous B lymphoblastoid cells

  • Cytokine profiling to characterize T helper cell polarization

Studies have demonstrated that Yersinia antigens selectively activate a Th1-like subset of T cells in patients with Yersinia-triggered reactive arthritis, with these cells producing IFN-γ but not IL-4 or IL-5 upon stimulation .

Antibody Response Evaluation:

  • ELISA using recombinant proteins as antigens

  • Recom-dot assays performed on nitrocellulose strips

  • Western blot analysis

For Y. enterocolitica protein detection, recombinant YopD has shown particular utility as an antigen in ELISA, with high specificity and sensitivity. In studies of patients suspected of yersiniosis, IgG antibodies to YopD were detected in 69.5% of cases versus less than 10% of healthy controls .

AntigenIgG Positive (%)IgA Positive (%)IgM Positive (%)
YopD69.542.440.7
V-Ag32.412.210.8
YopB27.010.814.9
YopE18.92.710.8

Data compiled from serological testing of patients suspected of yersiniosis using recombinant Yop proteins in ELISA and recom-dot assays

What are the key challenges in expressing and purifying functional membrane proteins like GlpG, and how can they be addressed?

Expressing and purifying functional membrane proteins like GlpG presents several key challenges:

1. Protein Misfolding and Aggregation:

  • Solution: Use specialized E. coli strains like C43(DE3) designed for membrane protein expression

  • Optimization: Lower induction temperatures (16-25°C) and reduced inducer concentrations

2. Detergent Selection for Solubilization:

  • Challenge: Different detergents can affect protein stability and activity

  • Approach: Screen multiple detergents; dodecyl-β-d-maltoside has proven effective for GlpG purification

3. Maintaining Native Conformation:

  • Strategy: Reconstitution into lipid nanodiscs or liposomes following purification

  • Assessment: Confirm proper folding through activity assays rather than relying solely on yield

4. Yield Quantification:

  • Method: Standardize protein yields through Coomassie staining after SDS/PAGE

  • Validation: Use multiple quantification approaches including LiCor infrared scanning

5. Activity Preservation:
For GlpG specifically, maintaining the native membrane environment is crucial for preserving the substrate gating mechanism, as detergent micelles may not provide the lateral pressure normally applied by membranes .

How can researchers verify the specificity of recombinant GlpG activity in vitro?

Verifying the specificity of recombinant GlpG activity requires multiple complementary approaches:

1. Substrate Specificity Testing:

  • Use multiple potential substrates including:

    • C100Spitz-Flag (contains the Spitz substrate motif)

    • C100-Flag (control lacking Spitz transmembrane residues)

  • Confirm GlpG cleaves only specific substrates (e.g., C100Spitz-Flag but not C100-Flag)

2. Cleavage Site Verification:

  • Perform mass spectrometry analysis of cleavage products

  • Confirm cleavage occurs at expected intramembrane sites (e.g., between alanine-serine and glycine-alanine residues within the transmembrane domain)

3. Active Site Mutations:

  • Generate catalytic serine mutants as negative controls

  • These mutants should express normally but lack proteolytic activity

4. Inhibitor Sensitivity:

  • Test sensitivity to mechanism-based inhibitors like 3,4-dichloroisocoumarin and diisopropyl fluorophosphonate

  • These compounds should inhibit wild-type GlpG but not catalytically inactive mutants

5. Competitive Substrate Assays:

  • Examine whether excess unlabeled substrate can compete with labeled substrate

  • This confirms binding site specificity rather than nonspecific degradation

How can structural dynamics data from techniques like solid-state NMR be integrated with functional studies to advance understanding of rhomboid proteases?

Integration of structural dynamics data with functional studies represents a powerful approach to understanding rhomboid proteases like GlpG:

Methodological Integration Framework:

  • Correlation of Dynamic Measurements with Activity:

    • Measure conformational dynamics using solid-state NMR relaxation dispersion experiments

    • Parallel assessment of proteolytic activity under identical conditions

    • Establish quantitative relationships between dynamics parameters and catalytic efficiency

  • Structure-Guided Mutagenesis Design:

    • Use NMR-identified dynamic hotspots (e.g., N-terminal part of TM5 and loop L4) to guide targeted mutagenesis

    • Assess how mutations affecting dynamics impact substrate binding and catalysis

    • Create a comprehensive dynamics-function map of the protein

  • Computational Modeling:

    • Use experimental dynamics data to constrain molecular dynamics simulations

    • Predict conformational transitions and energy landscapes

    • Test computational predictions through additional experiments

This integrated approach has already revealed that TM5 exists in conformational exchange between open and closed states, providing crucial insights into the substrate gating mechanism .

What experimental approaches can be used to identify physiological substrates of GlpG in Y. enterocolitica?

Identifying physiological substrates of GlpG in Y. enterocolitica requires sophisticated experimental approaches:

1. Comparative Proteomics:

  • Compare membrane proteomes of wild-type and glpG-deficient Y. enterocolitica

  • Look for proteins with altered processing patterns using techniques like:

    • SILAC (Stable Isotope Labeling with Amino acids in Cell culture)

    • TMT (Tandem Mass Tag) labeling

    • Label-free quantitative proteomics

2. Substrate Trapping:

  • Generate catalytically inactive GlpG mutants that can bind but not cleave substrates

  • Perform crosslinking followed by immunoprecipitation to capture substrate complexes

  • Identify trapped proteins by mass spectrometry

3. Genetic Interaction Screening:

  • Screen for genetic suppressors or synthetic phenotypes with glpG mutations

  • Analyze pathway relationships to identify potential substrate pathways

4. Bioinformatic Prediction:

  • Use machine learning approaches trained on known rhomboid protease substrates

  • Focus on membrane proteins with helical distortions that might facilitate substrate recognition

5. In Vitro Screening:

  • Express and purify candidate membrane proteins

  • Test for direct cleavage by GlpG under controlled conditions

  • Validate with site-directed mutagenesis of predicted cleavage sites

The integration of multiple approaches is essential, as single methods alone may miss physiologically relevant substrates or identify false positives.

How conserved is GlpG across different Yersinia species and other bacterial pathogens, and what does this suggest about its functional importance?

While the search results don't provide specific information about GlpG conservation across Yersinia species, we can address this question based on general principles and available information about rhomboid proteases:

Rhomboid proteases like GlpG are widely distributed across bacteria, archaea, and eukaryotes, suggesting an ancient evolutionary origin and fundamental biological importance. For a comprehensive analysis of GlpG conservation, researchers should:

  • Perform comparative genomic analysis across multiple Yersinia species and strains

  • Analyze both sequence conservation and genomic context

  • Compare expression patterns across different conditions

  • Assess whether glpG is part of the core genome or the accessory genome

The presence of glpG in Y. enterocolitica implies potential roles in basic cellular functions such as membrane protein quality control or specific pathogenicity mechanisms.

To experimentally assess functional conservation, researchers could:

  • Express GlpG homologs from different Yersinia species in a common background

  • Test their ability to complement glpG deficiency

  • Compare substrate specificity profiles

How do the structural and functional properties of Y. enterocolitica GlpG compare to other bacterial rhomboid proteases?

To systematically compare Y. enterocolitica GlpG with other bacterial rhomboid proteases, researchers should consider:

Structural Comparisons:

  • Core architecture: The six transmembrane helices and active site configuration are highly conserved across bacterial rhomboid proteases

  • Gating mechanism: The lateral displacement of TM5 appears to be a common feature in rhomboid proteases, though fine details may vary between species

  • Loop regions: These show greater variability and may contribute to species-specific functions or regulation

Functional Comparisons:

  • Substrate specificity: Different bacterial rhomboid proteases may recognize distinct sequence motifs

  • Catalytic efficiency: Kinetic parameters can vary significantly between homologs

  • Regulation: Expression patterns and activity modulation may be species-specific

Experimental Approaches for Comparative Studies:

  • Heterologous expression of multiple rhomboid proteases in a common system

  • Testing against a standardized panel of substrates

  • Structural studies (X-ray crystallography, NMR) under identical conditions

  • Creation of chimeric proteins to identify specificity-determining regions

Such comparative studies could reveal evolutionary adaptations of rhomboid proteases to specific bacterial niches and pathogenic lifestyles.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.