Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B sn-glycerol-3-phosphate transport system permease protein ugpA (ugpA)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant UgpA

Recombinant UgpA is a full-length permease protein expressed in Escherichia coli with an N-terminal His tag for purification . It is derived from the pathogenic American biotype 1B strain of Y. enterocolitica serotype O:8, which is associated with severe human infections . The protein is part of the UgpACE transport system, which facilitates the uptake of sn-glycerol-3-phosphate (G3P) and glycerophosphoryl diesters, essential for bacterial survival under phosphate-limiting conditions .

Functional Role in Y. enterocolitica

UgpA operates within the UgpACE system:

  • Substrate Binding: UgpB (periplasmic binding protein) captures G3P, while UgpA and UgpE form the permease channel .

  • Pathogen Adaptation: Biotype 1B strains like serotype O:8 are highly virulent, and UgpA may support survival in host environments by scavenging phosphate .

  • Regulatory Links: Proteins like OmpR, which modulate urease expression in biotype 1B strains, may indirectly influence UgpA activity under stress .

Production and Quality Control

Recombinant UgpA is produced under optimized conditions:

  • Expression: Induced in E. coli with IPTG .

  • Reconstitution: Lyophilized protein is solubilized in sterile water (0.1–1.0 mg/mL) with glycerol for stability .

  • Validation: Confirmed via SDS-PAGE and mass spectrometry .

Research Applications

  • Transport Mechanism Studies: Used to dissect G3P uptake kinetics and membrane protein interactions .

  • Antimicrobial Target Screening: Potential candidate for inhibiting nutrient uptake in pathogenic Yersinia .

  • Structural Biology: Supports crystallography or cryo-EM studies due to high purity .

Comparative Analysis of Ugp System Components

The UgpACE system includes three subunits:

ComponentFunctionUniProt IDLength (aa)
UgpAPermease (membrane channel)A1JID8295
UgpEPermease (ATP-binding)A1JID9281
UgpBPeriplasmic substrate-binding proteinA1JID7343

Data from highlight synergistic roles in substrate transport.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
The shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ugpA; YE0242; sn-glycerol-3-phosphate transport system permease protein UgpA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-295
Protein Length
full length protein
Species
Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Target Names
ugpA
Target Protein Sequence
MSSSRPGFSCSWLPYLLVLPQLAITAVFFLWPAGEALWYSVQMLDPFGLSSEFVGLSNFI ALFHDEYYLASFYTTLIFSSLVAGIGLVVSLFLAAMVDYVLRGSRIYQTLMILPYAVAPA VAAVLWIFLFNPGLGLITHFLASLGYNWNHAQNSGQAMFLVVLASVWKQISYNFLFFLAA LQSIPRSLVEAAAIDGAGPVRRFFNLVLPLISPVSFFLLVVNLVYAFFDTFPVIDAATGG GPMQATTTLIYKIYREGFAGLDLSSSAAQSVVLMLLVIGLTVIQFRFVERKVRYQ
Uniprot No.

Target Background

Function
This protein plays a role in the binding-protein-dependent transport system for sn-glycerol-3-phosphate. It is likely responsible for translocating the substrate across the membrane.
Database Links

KEGG: yen:YE0242

STRING: 393305.YE0242

Protein Families
Binding-protein-dependent transport system permease family, UgpAE subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of the ugpA protein in Yersinia enterocolitica?

UgpA functions as an integral membrane permease component of the sn-glycerol-3-phosphate ABC transporter system (UgpABCE) in Yersinia enterocolitica. It is primarily responsible for the translocation of the substrate across the cytoplasmic membrane . Within the transport complex, UgpA forms part of the transmembrane channel through which sn-glycerol-3-phosphate passes after being captured by the periplasmic binding protein. The protein works in concert with UgpE (the second permease component) and UgpC (the ATPase component) to facilitate substrate import. This transport system is essential for bacteria to acquire phosphate and carbon sources from their environment, particularly in phosphate-limited conditions.

How is the sn-glycerol-3-phosphate transport system structured in Yersinia enterocolitica?

The sn-glycerol-3-phosphate transport system in Y. enterocolitica operates through a binding protein-dependent ATP-binding cassette (ABC) transporter mechanism. The system consists of four main components arranged in a functional complex:

ComponentProteinFunction
Periplasmic binding proteinUgpBCaptures sn-glycerol-3-phosphate in the periplasm
Permease proteinsUgpA and UgpEForm the transmembrane channel
ATP-binding componentUgpCProvides energy through ATP hydrolysis

The transport process follows several steps:

  • UgpB binds sn-glycerol-3-phosphate in the periplasm

  • The UgpB-substrate complex interacts with the UgpA/UgpE channel complex

  • UgpC hydrolyzes ATP, inducing conformational changes in the permease components

  • These changes facilitate substrate translocation across the membrane into the cytoplasm

What experimental methods are most effective for studying ugpA function?

Several experimental approaches can be employed to study ugpA function:

Genetic approaches:

  • Gene knockout/complementation: Creating ugpA deletion mutants and complementing with wild-type or mutated versions to assess functional changes

  • Site-directed mutagenesis: Modifying specific conserved residues to determine their importance in transport function

Biochemical approaches:

  • Transport assays: Using radiolabeled substrates (e.g., 33P-labeled sn-glycerol-3-phosphate) to measure uptake rates in wild-type versus mutant strains

  • Methotrexate-agarose affinity chromatography: Can be used to study protein-substrate interactions, similar to methods used for other transport systems

Structural approaches:

  • Membrane protein purification: Isolating the UgpA protein while maintaining its native conformation

  • Structural analysis: Using techniques like X-ray crystallography or cryo-electron microscopy to determine three-dimensional structure

Interaction studies:

  • Co-immunoprecipitation: Identifying protein-protein interactions within the ABC transporter complex

  • Bacterial two-hybrid assays: Confirming direct interactions between UgpA and other components

These methodologies can be complementary and should be selected based on the specific research question being addressed.

How does the structure of ugpA contribute to substrate specificity and translocation?

The structure-function relationship of UgpA in substrate specificity and translocation involves multiple elements:

Key structural elements:

  • Transmembrane helices forming the substrate pathway

  • Conserved residues that interact directly with sn-glycerol-3-phosphate

  • Interface regions that interact with the ATP-binding component (UgpC)

  • Regions that undergo conformational changes during the transport cycle

Studies on related ABC transporters have identified conserved motifs critical for function. For example, mutations in invariant glycines and leucines within the transmembrane domains significantly affect transport activity . The two conserved permease motifs appear to have different functional importance, with mutations in motif 2 typically having more pronounced effects on transport efficiency than mutations in motif 1.

Experimental evidence from related transporters suggests that these effects arise because:

  • Conserved glycines provide flexibility for conformational changes during transport

  • Conserved leucines may be involved in substrate binding or in maintaining proper protein folding

  • The two permease components (UgpA and UgpE) must interact precisely to form a functional channel

These structural features collectively determine both the substrate specificity and transport efficiency of the system.

Can components of the ugpABCE system be functionally exchanged with other ABC transporters?

Yes, components of the ugpABCE system demonstrate functional exchangeability with other ABC transporters, particularly those with similar structures. Experimental evidence shows:

  • UgpC (the ATPase component) can restore growth of a malK mutant on maltose when expressed at sufficient levels

  • Conversely, MalK (the maltose system ATPase) can complement ugpC mutants for growth on glycerol-3-phosphate, although less efficiently than UgpC

The efficiency of these hybrid transporters is reduced compared to native systems due to suboptimal protein-protein interactions. For example, "UgpC has a higher affinity for UgpA and UgpE than for MalF and MalG," explaining the reduced efficiency of hybrid transporters .

This functional exchangeability has significant implications:

  • It confirms the modular architecture of ABC transporters

  • It demonstrates that substrate specificity is primarily determined by the permease components and binding proteins

  • It suggests that the energy-coupling mechanism is highly conserved across different ABC transporter systems

  • It opens possibilities for creating engineered transport systems with novel specificities through domain swapping

This principle extends to other ABC transporters, as similar observations have been made with components of the Ugp and Mal systems in other bacterial species.

What is the role of ATP hydrolysis in ugpA function and how is it coupled to substrate transport?

ATP hydrolysis plays a crucial role in powering substrate translocation through the UgpA/UgpE channel. The process follows a coordinated mechanism:

  • UgpC contains the ATP-binding domain and is responsible for ATP hydrolysis

  • The energy from ATP hydrolysis induces conformational changes in UgpC

  • These conformational changes are transmitted to the UgpA/UgpE permease complex

  • The resulting structural rearrangements in the transmembrane domains of UgpA and UgpE alter the accessibility of the substrate-binding site

  • This alternating access mechanism allows substrate movement from the periplasmic side to the cytoplasmic side of the membrane

Evidence from studies on related ABC transporters indicates that ATPase activity increases when the substrate is bound to the periplasmic binding protein . This suggests a coordinated mechanism where substrate binding triggers ATP hydrolysis, which in turn drives translocation.

The coupling between ATP hydrolysis and transport involves specific protein-protein interactions between UgpC and the transmembrane domains of UgpA and UgpE. Mutations that disrupt these interactions typically result in non-functional transporters despite normal complex formation.

Interestingly, "the soluble AlgS protein was detected in the membrane fraction," suggesting that the ATPase component of ABC transporters associates with the membrane through interactions with the permease components .

How do mutations in ugpA affect transport efficiency and bacterial survival?

Mutations in ugpA can have diverse effects on transport efficiency and bacterial survival, depending on the nature and location of the mutations:

Impact of specific mutations based on studies of related transporters:

Mutation TypeEffect on TransportMechanism
Conserved glycine in motif 2 (G418A)Attenuated transportDisrupts conformational flexibility
Conserved glycine in motif 1 (G155A/V/E)Minimal effectLess critical for function
Conserved leucine (L154D)Attenuated transportAffects protein folding or interactions
Conserved leucine (L417D)Complete loss of functionCritical for channel structure

The consequences for bacterial survival depend on environmental conditions:

  • In phosphate-limited environments, transport-deficient mutants would be at a significant disadvantage

  • During infection, reduced transport efficiency might attenuate virulence by limiting access to essential nutrients

  • In nutrient-rich laboratory conditions, the effects might be less pronounced due to redundancy in phosphate acquisition systems

Experimental approaches to characterize these effects include:

  • Competitive growth assays between wild-type and mutant strains

  • Quantitative transport assays with radiolabeled substrates

  • In vivo infection models to assess the impact on virulence

Understanding the specific effects of different mutations provides insights into the structure-function relationships within the transport system and may identify vulnerable points for therapeutic targeting.

How does the Yersinia enterocolitica ugpA compare with homologous proteins in other pathogenic bacteria?

Comparative analysis of the Y. enterocolitica ugpA with homologous proteins in other pathogenic bacteria reveals important evolutionary relationships and functional conservation:

The ugpA protein belongs to a highly conserved family of ABC transporter permease components found across many bacterial species. Key comparisons include:

The properties of ABC transporters across different pathogenic species highlight their importance in bacterial physiology and potential as therapeutic targets.

Can recombinant ugpA be used in vaccine development against Yersinia enterocolitica?

The potential of recombinant UgpA as a vaccine component against Yersinia enterocolitica can be evaluated based on immunological and practical considerations:

Supporting evidence:

  • Other Yersinia proteins have shown promise as vaccine components. For example, recombinant Yersinia outer proteins (Yops) have been tested with varying success in protective immunity studies .

  • A bivalent fusion protein comprising regions of Y. pestis LcrV and YopE proteins (rVE) demonstrated protection against Y. enterocolitica challenge .

  • Comprehensive protection against Yersinia requires both humoral and cell-mediated immune responses .

Challenges and considerations:

A strategic approach for exploring UgpA as a vaccine component would include:

  • Identifying surface-exposed epitopes

  • Testing the immunogenicity of recombinant UgpA fragments

  • Assessing protective efficacy in animal models

  • Considering fusion protein approaches similar to the successful rVE construct

What role might the ugpA protein play in Yersinia enterocolitica virulence and host-pathogen interactions?

While ugpA is not classified as a classical virulence factor like adhesins or toxins, it may contribute indirectly to Y. enterocolitica pathogenicity through several mechanisms:

Nutrient acquisition during infection:

  • Efficient phosphate acquisition is critical for bacterial survival in nutrient-limited host environments

  • The UgpABCE system may provide a competitive advantage during colonization

  • Pathogens typically upregulate nutrient acquisition systems during infection

Potential interactions with host immune system:

Comparative virulence considerations:

  • Different Y. enterocolitica serotypes show varying virulence properties

  • Serotype O:3 strains, the most frequent cause of human yersiniosis, have unique adhesion and invasion properties

  • While not specifically linked to UgpA, these differences highlight how seemingly small variations in bacterial proteins can significantly impact pathogenicity

Research approaches to investigate potential virulence contributions:

  • Creating ugpA knockout mutants and testing colonization ability in animal models

  • Comparing expression levels between clinical and environmental isolates

  • Examining ugpA expression during different stages of infection

  • Testing competitive fitness between wild-type and ugpA mutants in vivo

The interplay between bacterial metabolism and virulence is increasingly recognized as important in understanding pathogenesis, making further investigation of UgpA's role in this context valuable.

What expression systems are most suitable for producing recombinant Y. enterocolitica ugpA protein?

Producing recombinant membrane proteins like ugpA presents unique challenges that require careful selection of expression systems and optimization strategies:

Bacterial expression systems:

  • E. coli-based systems:

    • Advantages: Rapid growth, high yields, well-established protocols

    • Challenges: Membrane proteins often form inclusion bodies

    • Optimization strategies:

      • Using specialized strains (C41/C43, Lemo21) designed for membrane protein expression

      • Testing different promoters (T7, tac, ara) for expression level control

      • Lowering induction temperature (16-25°C) to slow expression and improve folding

      • Adding fusion tags (MBP, SUMO) to enhance solubility

  • Cell-free expression systems:

    • Advantages: Direct synthesis into artificial membranes or detergent micelles

    • Applications: Useful for structural studies or functional assays requiring purified protein

    • Example protocol: Similar to methods used for expressing Yersinia outer proteins where PCR-amplified genes are cloned and expressed in E. coli

Purification approaches:

For functional studies of UgpA, purification strategies must maintain the native conformation:

  • Detergent solubilization (e.g., DDM, LMNG)

  • Affinity chromatography using tags (His, FLAG)

  • Size exclusion chromatography for further purification

A similar approach to that used for Yersinia YopE-DHFR fusion proteins could be adapted, where affinity chromatography with methotrexate-agarose was employed to purify functional protein complexes .

Validation methods:

  • Western blotting to confirm expression

  • Transport assays to verify functionality

  • Circular dichroism to assess secondary structure

  • Mass spectrometry to confirm protein identity

When designing the expression construct, including only the permease domain without the signal sequence often improves expression yields in heterologous systems.

How can researchers effectively study interactions between ugpA and other components of the ABC transporter system?

Investigating the interactions between UgpA and other components of the ABC transporter system requires specialized approaches for membrane protein complexes:

In vitro interaction studies:

  • Co-purification methods:

    • Tandem affinity purification using differentially tagged components

    • Blue native PAGE to preserve native protein complexes

    • Size exclusion chromatography of solubilized complexes

  • Biophysical techniques:

    • Surface plasmon resonance (SPR) to measure binding affinities

    • Microscale thermophoresis for quantitative interaction analysis

    • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

In vivo interaction studies:

  • Genetic approaches:

    • Bacterial two-hybrid assays adapted for membrane proteins

    • Suppressor mutation analysis to identify compensatory mutations

    • Functional complementation assays similar to those used to demonstrate UgpC-MalK exchangeability

  • Imaging techniques:

    • Förster resonance energy transfer (FRET) with fluorescently labeled components

    • Proximity labeling methods (BioID, APEX) to identify closely associated proteins

Functional validation:

Transport assays provide the ultimate validation of productive interactions:

  • Reconstitution of purified components in proteoliposomes

  • Transport assays with radiolabeled substrates

  • ATP hydrolysis assays to measure coupling between components

From existing research, we know that "UgpC has a higher affinity for UgpA and UgpE than for MalF and MalG" , highlighting the importance of specific protein-protein interactions for optimal transporter function. These interactions can be quantified using the methods described above.

What analytical techniques are most effective for studying the structure-function relationship of ugpA?

Understanding the structure-function relationship of ugpA requires a multi-faceted approach combining structural analysis with functional assays:

Structural analysis techniques:

  • High-resolution structural methods:

    • X-ray crystallography (challenging for membrane proteins)

    • Cryo-electron microscopy (increasingly powerful for membrane protein complexes)

    • NMR spectroscopy (typically limited to specific domains or fragments)

  • Computational approaches:

    • Homology modeling based on related ABC transporters

    • Molecular dynamics simulations to study conformational changes

    • Protein-substrate docking to predict binding interactions

Functional mapping approaches:

  • Targeted mutagenesis:

    • Alanine scanning of conserved residues

    • Domain swapping with related transporters

    • Introduction of cysteine pairs for crosslinking studies

  • Accessibility studies:

    • Substituted cysteine accessibility method (SCAM)

    • Site-directed fluorescence labeling to track conformational changes

    • Hydrogen-deuterium exchange to identify exposed regions

Correlating structure with function:

As demonstrated in studies of related transporters, specific mutations can have predictable effects on function:

  • Mutations in conserved glycines affect conformational flexibility

  • Mutations in conserved leucines disrupt structural integrity

  • Mutations at the UgpA-UgpC interface impair energy coupling

A comprehensive approach combines these techniques to:

  • Identify critical residues involved in substrate binding

  • Map the conformational changes during the transport cycle

  • Understand the molecular basis of substrate specificity

  • Characterize the interactions with other transporter components

These insights are essential for potential therapeutic targeting of the transport system.

How can isotope labeling techniques be applied to study ugpA-mediated transport in Yersinia enterocolitica?

Isotope labeling provides powerful tools for studying the kinetics and mechanism of ugpA-mediated transport in Yersinia enterocolitica:

Substrate transport assays:

  • Radioisotope labeling:

    • 33P or 32P-labeled sn-glycerol-3-phosphate to track substrate transport

    • 35S-labeled methionine for protein synthesis studies

  • Stable isotope labeling:

    • 13C-labeled substrates for metabolic tracking

    • 2H or 15N labeling for NMR structural studies

    • Applications:

      • Metabolic flux analysis to track substrate utilization

      • Protein-substrate interactions using NMR

      • Quantitative proteomics to measure transporter abundance

Advanced transport studies:

  • Reconstituted systems:

    • Purified components in proteoliposomes

    • Inside-out membrane vesicles for ATP-dependent uptake studies

    • These systems allow precise control of conditions and components

  • Real-time measurements:

    • Fluorescent substrate analogs for continuous monitoring

    • pH-sensitive dyes to detect co-transport of protons

    • Membrane potential-sensitive dyes to measure electrogenic transport

Similar approaches have been successfully employed with other ABC transporters, as seen in studies where "55Fe transport assays" were used to measure transport activity in mutant versions of related transporters .

The quantitative data obtained from these assays can be analyzed to determine:

  • Transport kinetics (Km, Vmax)

  • Energetic coupling efficiency

  • Effects of inhibitors or mutations

  • Substrate specificity profiles

What are the common challenges in purifying functional ugpA protein and how can they be overcome?

Purifying functional membrane proteins like ugpA presents several technical challenges that require specific strategies to overcome:

Common challenges and solutions:

ChallengeManifestationSolutions
Low expression yieldsMinimal protein detected by Western blotUse specialized strains (C41/C43, Lemo21); Optimize induction conditions; Consider fusion tags
Protein aggregationInclusion body formationLower expression temperature; Use mild detergents; Include stabilizing agents (glycerol, specific lipids)
Loss of native structureLoss of functionality after purificationScreen multiple detergents; Include native lipids; Purify entire complex rather than individual components
Detergent interferenceArtifacts in functional assaysUse detergent-compatible assays; Consider nanodiscs or amphipols for detergent removal
Co-purification contaminantsAdditional bands on SDS-PAGEImplement multiple purification steps; Use size exclusion as final step; Consider on-column folding approaches

Optimized purification workflow:

  • Membrane preparation:

    • Gentle cell lysis (e.g., French press)

    • Ultracentrifugation to isolate membrane fraction

    • Washing steps to remove peripheral proteins

  • Solubilization screening:

    • Test panel of detergents (DDM, LMNG, CHAPSO)

    • Optimize detergent:protein ratio

    • Include stabilizers based on screening results

  • Affinity purification:

    • Immobilized metal affinity chromatography for His-tagged constructs

    • Gentle elution conditions (imidazole gradient)

    • Buffer optimization to maintain stability

  • Quality assessment:

    • Size exclusion chromatography to verify monodispersity

    • Functional assays to confirm native conformation

    • Thermal stability assays to optimize buffer conditions

Lessons from related proteins suggest that purifying the entire UgpABC complex rather than individual components may improve stability and functionality, as the proteins likely stabilize each other in their native state.

How can researchers differentiate between ugpA and other membrane transporters with similar functions in experimental settings?

Differentiating ugpA from other membrane transporters with similar functions requires specialized approaches that exploit their unique characteristics:

Genetic approaches:

  • Gene deletion and complementation:

    • Create clean deletion mutants (ΔugpA)

    • Complement with plasmid-encoded ugpA

    • Use growth phenotypes on selective media to confirm specificity

  • Promoter reporter fusions:

    • Create transcriptional/translational fusions to reporter genes

    • Monitor expression under different conditions

    • Differentiate regulation patterns specific to ugpA

Biochemical differentiation:

  • Substrate specificity profiling:

    • Compare transport rates of sn-glycerol-3-phosphate versus other phosphate sources

    • Use competitive inhibition assays with substrate analogs

    • Exploit the ability of UgpABCE to transport glycerophosphoryl diesters

  • Immunological methods:

    • Develop specific antibodies against unique epitopes in UgpA

    • Use for Western blotting, immunoprecipitation, or immunofluorescence

    • Epitope tagging for detection and purification

Functional discrimination:

  • Transport assays with specific inhibitors:

    • Identify compounds that specifically inhibit UgpA-mediated transport

    • Use in combination with radiolabeled substrate uptake assays

    • Compare inhibition profiles across different transporters

  • Exploitation of ABC transporter differences:

    • ATP dependence and hydrolysis rates

    • Interaction with specific binding proteins

    • Response to osmotic or pH changes

Research on related transporters has shown that "Although the substrate specificities of the Ugp and the Mal systems differ widely and the UgpC and MalK proteins could be functionally exchanged, the presence of a substrate-binding site on these proteins, which is essential for the functioning and the substrate specificities of the cognate permeases, seems to be highly unlikely" . This insight can be leveraged to design experimental approaches that distinguish between functionally similar but mechanistically distinct transport systems.

What controls and validation steps are essential when studying recombinant ugpA expression and function?

Rigorous controls and validation steps are crucial when studying recombinant ugpA to ensure reliable and reproducible results:

Expression validation:

  • Protein detection controls:

    • Western blotting with tag-specific and protein-specific antibodies

    • Mass spectrometry confirmation of protein identity

    • Comparison to non-induced samples and empty vector controls

  • Localization verification:

    • Membrane fractionation to confirm membrane integration

    • Protease accessibility assays to determine topology

    • Fluorescent protein fusions to visualize cellular localization

Functional validation:

  • Transport activity controls:

    • Comparison to wild-type levels in native system

    • Negative controls using inactive mutants (e.g., equivalent to the L417D mutation in related transporters )

    • Substrate specificity testing with structurally related compounds

  • Complementation controls:

    • Expression in ugpA knockout strains

    • Growth phenotype rescue on selective media

    • Comparison to empty vector and overexpression toxicity controls

Interaction validation:

  • Complex formation verification:

    • Co-purification with other components (UgpB, UgpC, UgpE)

    • Blue native PAGE to assess complex integrity

    • Analytical size exclusion chromatography to confirm stoichiometry

  • Energy coupling assessment:

    • ATP hydrolysis assays in reconstituted systems

    • Vanadate sensitivity testing (typical inhibitor of ABC transporters)

    • Mutation of conserved motifs as negative controls

Critical experimental design considerations:

  • Include proper internal controls in each experiment

  • Perform biological replicates (minimum n=3) for quantitative analyses

  • Validate with multiple complementary approaches

  • Test concentration-dependent effects for substrate and inhibitor studies

  • Include time-course measurements for transport kinetics

Similar validation approaches were employed in studies of YopE fusion proteins, where "secretion-deficient as well as secretion-competent YopE-DHFR fusions complexed to SycE can be efficiently purified from Yersinia cytosol by affinity chromatography using methotrexate-agarose" , confirming both expression and expected interactions.

What emerging technologies could advance our understanding of ugpA structure and function?

Several cutting-edge technologies have the potential to significantly advance our understanding of ugpA structure and function:

Structural biology innovations:

  • Cryo-electron microscopy advancements:

    • Single-particle analysis at near-atomic resolution

    • Time-resolved cryo-EM to capture transport intermediates

    • Focused refinement techniques for flexible regions

  • Integrative structural approaches:

    • Combining cryo-EM, crosslinking mass spectrometry, and molecular dynamics

    • In-cell structural determination methods

    • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

Functional analysis innovations:

  • Advanced membrane protein tools:

    • Nanodiscs and styrene-maleic acid lipid particles (SMALPs) for detergent-free purification

    • Microfluidic platforms for high-throughput functional screening

    • Single-molecule transport assays to observe individual transport events

  • Genetic engineering advancements:

    • CRISPR-Cas9 for precise genomic modifications

    • Directed evolution approaches to engineer altered specificity

    • Unnatural amino acid incorporation for site-specific probes

In vivo investigation technologies:

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize transporter distribution and dynamics

    • Fluorescent substrate analogs for real-time transport visualization

    • Correlative light and electron microscopy for structural context

  • Systems biology approaches:

    • Multi-omics integration to understand regulation networks

    • Machine learning for predicting structure-function relationships

    • Metabolic flux analysis to quantify transport impacts

These technologies could address key questions such as:

  • What is the complete conformational cycle during transport?

  • How does substrate binding trigger ATP hydrolysis?

  • What is the stoichiometry and assembly pathway of the complex?

  • How do environmental conditions regulate transporter function?

The application of these advanced methods to ugpA would build upon approaches used in studies of related transporters, where techniques like site-directed mutagenesis and transport assays have already provided valuable insights .

How might ugpA and related transporters be exploited for biotechnological applications?

The unique properties of ugpA and related ABC transporters present several opportunities for biotechnological applications:

Engineered transport systems:

  • Modified substrate specificity:

    • Engineering UgpA through directed evolution or rational design to transport novel substrates

    • Creating chimeric transporters with domains from different systems

    • Applications in biosensors and bioremediation

  • Enhanced uptake systems:

    • Overexpression of optimized transporters to improve nutrient utilization

    • Engineering strains for enhanced phosphate accumulation

    • Applications in biofertilizer development and phosphate recovery

Therapeutic and diagnostic applications:

  • Drug delivery strategies:

    • Exploiting knowledge of bacterial transport mechanisms for antibiotic design

    • Developing "Trojan horse" compounds that hijack transport systems

    • Creating transport inhibitors as novel antimicrobials

  • Biosensor development:

    • Using purified components in artificial membrane systems as detection elements

    • Engineering whole-cell biosensors based on transporter activity

    • Applications in environmental monitoring and diagnostics

Vaccine development platforms:

  • Novel antigen delivery:

    • Incorporating UgpA epitopes into multicomponent vaccines

    • Using the principles from successful Yersinia vaccine candidates like the bivalent fusion protein (rVE)

    • Exploring membrane vesicles containing UgpA as vaccine carriers

  • Adjuvant research:

    • Investigating bacterial components as potential immunostimulants

    • Exploring membrane protein incorporation into nanoparticle delivery systems

The approach of engineering these systems could build on successful examples like the recombinant Y. pseudotuberculosis strain that "simultaneously delivers Y. pestis LcrV and F1" and "stimulated potent antibody responses" , demonstrating how bacterial components can be repurposed for beneficial applications.

What are the most promising directions for targeting ugpA or related transport systems for antimicrobial development?

Targeting bacterial transport systems like ugpA represents a promising strategy for developing novel antimicrobials with potentially reduced resistance potential:

Therapeutic targeting approaches:

  • Direct transport inhibition:

    • Small molecule inhibitors that block the substrate-binding site

    • Compounds that interfere with UgpA-UgpE interactions

    • Molecules that prevent conformational changes during transport

    • Advantages: Potential specificity for bacterial transporters

  • Energy coupling disruption:

    • Compounds that interfere with UgpA-UgpC interactions

    • Molecules that prevent ATP hydrolysis or energy coupling

    • Inhibitors that lock the transporter in one conformational state

    • Rationale: ATP hydrolysis is essential for transport function

  • Exploiting the transport system:

    • "Trojan horse" compounds that are transported by UgpABCE but toxic once inside

    • Conjugation of existing antibiotics to substrates recognized by the transporter

    • Strategy: Improve delivery of antimicrobials into bacterial cells

Target validation approaches:

  • Genetic validation:

    • Assess growth phenotypes of ugpA deletion mutants in infection-relevant conditions

    • Test competitive fitness of mutants in co-culture experiments

    • Determine if redundant transporters exist that could compensate for inhibition

  • Chemical validation:

    • Identify natural product inhibitors as starting points

    • Develop high-throughput screening assays for transport activity

    • Create target-based assays measuring ATP hydrolysis coupled to transport

Resistance consideration factors:

  • Resistance mechanism assessment:

    • Evaluate barrier to resistance development

    • Identify potential bypass mechanisms

    • Consider dual-targeting approaches to reduce resistance potential

  • Specificity optimization:

    • Focus on structural differences between bacterial and host transporters

    • Target regions unique to pathogenic species

    • Develop narrow-spectrum inhibitors for specific pathogens

The established effectiveness of targeting bacterial virulence factors in Yersinia provides a foundation for exploring similar approaches with transport systems, potentially offering alternatives to conventional antibiotics.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.