Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Sulfoxide reductase heme-binding subunit YedZ (yedZ)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your preferred tag type at the time of ordering to allow for preferential development.
Synonyms
msrQ; YE3809; Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ; Flavocytochrome MsrQ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-199
Protein Length
full length protein
Species
Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Target Names
msrQ
Target Protein Sequence
MRLTLRQIKWLKVAIWLAAALPFLWLILSVDQGWFSADPAKDIQHFTGRMTLKLLLATLL VTPLARYGKQPLLIRCRRLLGLWCFAWGTLHLVSYSVLELGLSNIGLLGRELVTRPYLTL GIISWLLLLSLAVTSTLWAQRKMGANWQKLHNLVYVVAILAPIHYLWSVKTLSPLPIIYA VTAAILLALRYKKFRQWCR
Uniprot No.

Target Background

Function

YedZ is a component of the MsrPQ system, which repairs oxidized periplasmic proteins containing methionine sulfoxide residues (Met-O) using respiratory chain electrons. This protective function safeguards proteins from oxidative stress damage caused by reactive oxygen and chlorine species generated by host defense mechanisms. MsrPQ is crucial for maintaining envelope integrity under bleach stress, rescuing a diverse range of periplasmic proteins from methionine oxidation. MsrQ facilitates electron transfer for reduction to the catalytic subunit MsrP, utilizing the quinone pool of the respiratory chain.

Database Links

KEGG: yen:YE3809

STRING: 393305.YE3809

Protein Families
MsrQ family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YedZ (MsrQ) in Yersinia enterocolitica and what is its functional significance?

YedZ, now commonly referred to as MsrQ in scientific literature, is an integral b-type heme-containing membrane-spanning protein that functions as a specific electron donor in the methionine sulfoxide reductase system (MsrPQ). This system is specifically involved in the repair of periplasmic proteins that have been oxidized by reactive compounds such as hypochlorous acid. The MsrPQ system consists of two proteins encoded in the same operon: MsrP (previously named YedY), a periplasmic protein with a molybdenum atom in its active site that carries out the methionine sulfoxide reductase activity, and MsrQ (YedZ), which acts as the specific electron donor for MsrP .

In Yersinia enterocolitica, a common foodborne pathogen, this system likely plays a crucial role in defense against oxidative stress during host infection, particularly when the bacteria encounter reactive oxygen species produced by host immune cells. The ability to repair oxidized proteins in the periplasm would contribute to Y. enterocolitica's virulence and survival within the host environment .

How does YedZ (MsrQ) relate to the evolutionary adaptations in Yersinia enterocolitica?

Yersinia enterocolitica has been subdivided into six distinct phylogroups based on recent phylogenetic analyses. The dominant phylogroups isolated from human infections (PG3-5) exhibit marked patterns of gain and loss of functions related to pathogenicity and metabolism. When considering proteins like YedZ/MsrQ that are involved in oxidative stress responses, these adaptations may reflect the evolutionary processes that have enabled Y. enterocolitica to occupy specific ecological niches .

Analysis of gene flow across Y. enterocolitica suggests that non-pathogenic PG1 strains act as reservoirs for genetic diversity, frequently serving as donors in recombination events. The distribution and sequence variations of genes encoding proteins like YedZ across different phylogroups may indicate adaptive evolution in response to different environmental pressures. Current research suggests that different Y. enterocolitica phylogroups may be ecologically separated, contrary to previous assumptions of shared ecological niches across the species .

What are the structural characteristics of YedZ (MsrQ) that enable its electron transport function?

YedZ/MsrQ is a membrane protein belonging to the FRD superfamily of heme-containing membrane proteins, which includes NADPH oxidase proteins (NOX/DUOX). The protein contains multiple transmembrane helices with specific histidine residues that coordinate b-type heme cofactors. Biochemical characterization of MsrQ has demonstrated that it can bind two b-type hemes through conserved histidine residues that are shared between the MsrQ and NOX protein families .

What are the optimal conditions for expressing and purifying recombinant YedZ (MsrQ) from Yersinia enterocolitica?

Expressing and purifying membrane proteins like YedZ/MsrQ presents significant challenges due to their hydrophobic nature and complex folding requirements. Based on successful approaches with similar proteins, the following methodology is recommended:

For expression, using E. coli as a heterologous host with a pET-28a expression vector has shown promising results for similar proteins. Codon optimization should be performed based on the expression host to enhance protein production. The addition of a fusion tag (such as GFP) can facilitate monitoring of expression levels and protein folding .

For optimal expression conditions:

  • Induction with 0.5-1.0 mM IPTG at OD600 of 0.6-0.8

  • Growth at a reduced temperature (16-18°C) after induction to enhance proper folding

  • Supplementation with δ-aminolevulinic acid (ALA, 1 mM) to support heme biosynthesis

  • Addition of iron source (100 μM FeSO4) to ensure adequate heme incorporation

For membrane solubilization and purification:

  • Harvest cells and resuspend in buffer containing protease inhibitors

  • Lyse cells using a French press or sonication

  • Isolate membrane fraction by ultracentrifugation (100,000 × g, 1 hour)

  • Solubilize membrane proteins using a mild detergent such as n-dodecyl-β-D-maltoside (DDM, 1%)

  • Purify using nickel affinity chromatography if a His-tag is incorporated

  • Further purify by size exclusion chromatography to obtain homogeneous protein

The purified protein should be verified for heme content by UV-visible spectroscopy, with characteristic Soret band absorbance at approximately 412 nm indicating properly incorporated heme cofactors .

How can researchers effectively analyze heme incorporation and binding in recombinant YedZ (MsrQ)?

Analyzing heme incorporation and binding in YedZ/MsrQ requires a combination of spectroscopic and biochemical approaches. The following methodological workflow is recommended:

  • UV-visible spectroscopy: This is the primary method for detecting and quantifying heme incorporation. Reduced and oxidized spectra should be collected from 300-700 nm. The Soret band at approximately 412 nm is characteristic of b-type hemes, and the ratio of this absorbance to protein concentration (measured at 280 nm) provides an estimate of heme incorporation efficiency .

  • Heme quantification: Precise quantification can be performed using the pyridine hemochromogen assay, where the protein is denatured in alkaline pyridine solution, reducing the heme, and measuring the characteristic absorption spectrum.

  • Site-directed mutagenesis: To identify specific residues involved in heme coordination, systematically mutate conserved histidine residues (particularly those corresponding to His-91, His-151, and His-164 identified in E. coli MsrQ) to alanine. Analyze the impact on heme content by normalizing the heme absorbance (412 nm) to protein concentration, as demonstrated in previous studies .

  • Resonance Raman spectroscopy: This technique provides detailed information about the heme environment and coordination state. Excitation at the Soret band maximum allows for enhanced detection of vibrational modes associated with the heme group.

  • Electron paramagnetic resonance (EPR): EPR spectroscopy of the oxidized protein can provide information about the spin state and coordination environment of the heme iron.

A typical data table for analysis of heme content in wild-type and mutant YedZ/MsrQ proteins would appear as follows:

Protein VariantAbsorbance Ratio (A412/A280)Relative Heme Content (%)Number of Hemes Bound
Wild-type2.15 ± 0.121002.0 ± 0.1
H91A0.15 ± 0.057 ± 20.14 ± 0.04
H151A1.23 ± 0.0957 ± 41.14 ± 0.08
H164A0.80 ± 0.0737 ± 30.74 ± 0.06

These methods collectively provide a comprehensive assessment of heme incorporation and the specific roles of different amino acid residues in heme binding .

What experimental approaches can be used to study the interaction between YedZ (MsrQ) and its electron donor proteins?

To characterize the interaction between YedZ/MsrQ and potential electron donor proteins like Fre (a flavin reductase related to the dehydrogenase domain of eukaryotic NOX enzymes), several complementary approaches can be employed:

  • Cross-linking experiments: Chemical cross-linking using agents like glutaraldehyde or BS3 (bis(sulfosuccinimidyl)suberate) can capture transient protein-protein interactions. The cross-linked complexes can be analyzed by SDS-PAGE and identified by mass spectrometry .

  • Surface Plasmon Resonance (SPR): This technique allows real-time monitoring of protein interactions with no labeling requirement. Immobilize purified YedZ/MsrQ on a sensor chip and flow solutions containing potential electron donor proteins at varying concentrations. Analysis of association and dissociation rates provides binding kinetics and affinity constants .

  • Isothermal Titration Calorimetry (ITC): ITC measures the heat released or absorbed during binding interactions, providing thermodynamic parameters (ΔH, ΔS, and Kd) that characterize the interaction.

  • Electron transfer kinetics: Using stopped-flow spectroscopy coupled with rapid-mixing techniques, measure the reduction rate of YedZ/MsrQ heme groups in the presence of electron donor proteins and NADPH. Monitor the absorbance changes at the Soret band (412 nm) to track the redox state of the heme groups.

  • Co-purification assays: Use pull-down assays with tagged versions of YedZ/MsrQ to identify interacting partners from cell lysates, followed by mass spectrometry identification.

  • Bacterial two-hybrid system: This genetic approach can identify protein interactions in vivo by linking potential interacting proteins to complementary fragments of a reporter enzyme.

The strength of the interaction between YedZ/MsrQ and electron donor proteins can be quantified using SPR data with a table format similar to:

Electron DonorAssociation Rate (ka, M⁻¹s⁻¹)Dissociation Rate (kd, s⁻¹)Equilibrium Constant (KD, nM)
Fre2.3 × 10⁵ ± 0.4 × 10⁵3.6 × 10⁻³ ± 0.5 × 10⁻³15.7 ± 2.3
FrdB1.1 × 10⁴ ± 0.3 × 10⁴7.2 × 10⁻² ± 1.1 × 10⁻²654.5 ± 87.2

These methodologies collectively provide a comprehensive understanding of the specific interactions between YedZ/MsrQ and its electron donor proteins, essential for mapping the complete electron transport chain in the MsrPQ system .

How does the functionality of YedZ (MsrQ) in Y. enterocolitica serotype O:8/biotype 1B differ from other Yersinia species and strains?

The functionality of YedZ/MsrQ may vary significantly across different Yersinia species and strains due to evolutionary adaptations to specific ecological niches. Y. enterocolitica has been divided into six distinct phylogroups, with the highly pathogenic serotype O:8/biotype 1B (belonging to PG1B) showing specific adaptations for virulence and survival in host environments .

Comparative genomic analyses suggest that strains from different phylogroups exhibit marked patterns of gain and loss of functions related to pathogenicity and metabolism. For YedZ/MsrQ specifically, sequence variations, expression levels, and functional efficiency may correlate with the virulence potential and ecological adaptations of different strains .

To investigate these differences, researchers should employ a multi-faceted approach:

  • Sequence analysis: Compare YedZ/MsrQ sequences across Yersinia species and strains to identify conserved domains and strain-specific variations, particularly in heme-binding regions and interaction interfaces with electron transport partners.

  • Expression profiling: Use qRT-PCR and proteomics to quantify YedZ/MsrQ expression levels under various stress conditions relevant to host infection (oxidative stress, acidic pH, nutrient limitation) across different strains.

  • Functional assays: Measure the methionine sulfoxide reductase activity of the MsrPQ system in different strains using purified proteins or membrane vesicles, focusing on the efficiency of electron transfer through YedZ/MsrQ.

  • Virulence correlation: Assess the relationship between YedZ/MsrQ functionality and virulence using animal infection models with wild-type and YedZ/MsrQ knockout strains from different Yersinia phylogroups.

A comparative analysis of YedZ/MsrQ across Yersinia species might reveal patterns similar to:

Yersinia Species/StrainSequence Identity to Y. enterocolitica O:8 YedZ (%)Expression Level Under Oxidative Stress (Fold Change)Methionine Sulfoxide Reductase Activity (nmol/min/mg)
Y. enterocolitica O:81007.5 ± 0.842.3 ± 3.7
Y. enterocolitica O:3925.2 ± 0.635.1 ± 2.9
Y. pseudotuberculosis854.3 ± 0.528.7 ± 2.4
Y. pestis843.9 ± 0.425.2 ± 2.1

Understanding these differences would provide insights into how the MsrPQ system has evolved to support the specific lifestyle and virulence strategies of different Yersinia species and strains .

What is the role of YedZ (MsrQ) in Yersinia enterocolitica pathogenesis and host-pathogen interactions?

The role of YedZ/MsrQ in Y. enterocolitica pathogenesis likely centers on defense against oxidative stress encountered during host infection. As part of the MsrPQ system, YedZ/MsrQ contributes to the repair of oxidized periplasmic proteins, particularly those with methionine residues that have been oxidized to methionine sulfoxide by reactive oxygen species (ROS) and hypochlorous acid produced by host immune cells .

To elucidate the specific contribution of YedZ/MsrQ to pathogenesis, researchers should consider these methodological approaches:

A typical data presentation for virulence assessment might include:

ParameterWild-type Y. enterocoliticaΔyedZ MutantComplemented Strain
Survival in 5 mM H₂O₂ (% of initial inoculum)68.5 ± 5.723.7 ± 4.263.2 ± 6.1
Survival in 50 μM HOCl (% of initial inoculum)52.3 ± 4.812.1 ± 2.349.5 ± 4.5
Intramacrophage survival (24h, log₁₀ CFU)5.7 ± 0.33.2 ± 0.45.4 ± 0.4
Mouse bacterial burden (liver, log₁₀ CFU/g)6.8 ± 0.54.1 ± 0.66.5 ± 0.5
Mouse survival rate (14 days, %)207025

This comprehensive approach would establish the contribution of YedZ/MsrQ to Y. enterocolitica pathogenesis and identify potential targets for therapeutic intervention .

How can structural similarities between YedZ (MsrQ) and eukaryotic NADPH oxidase components inform novel antibiotic development strategies?

The identification of YedZ/MsrQ as part of a prokaryotic two-component protein system related to the eukaryotic NADPH oxidase (NOX) family presents an intriguing opportunity for antibiotic development. Understanding these structural similarities could guide the design of compounds that selectively inhibit the bacterial protein while sparing human counterparts .

To leverage this knowledge for antibiotic development, researchers should pursue the following methodological approaches:

  • Comparative structural analysis: Generate high-resolution structures of YedZ/MsrQ using X-ray crystallography or cryo-electron microscopy, and compare with existing structures of eukaryotic NOX components to identify unique features in the bacterial protein that could be targeted.

  • Molecular docking and virtual screening: Use structure-based computational approaches to screen virtual libraries of compounds for those that bind selectively to bacterial YedZ/MsrQ but not to human NOX proteins.

  • Development of biochemical assays: Establish high-throughput assays measuring YedZ/MsrQ electron transfer activity for screening compound libraries, ideally in a format that allows parallel testing against human NOX proteins to ensure selectivity.

  • Structure-activity relationship (SAR) studies: For promising lead compounds, systematically modify chemical structures to optimize binding affinity, selectivity, and pharmacokinetic properties.

  • In vitro efficacy testing: Evaluate the ability of lead compounds to inhibit growth of Y. enterocolitica and other pathogenic bacteria under conditions requiring YedZ/MsrQ function, particularly oxidative stress conditions.

  • Assessment of resistance development: Determine the frequency and mechanisms of resistance development against YedZ/MsrQ inhibitors to anticipate potential clinical limitations.

A sample data table for compound screening results might appear as:

Compound IDIC₅₀ for Y. enterocolitica YedZ (μM)IC₅₀ for Human NOX2 (μM)Selectivity IndexMIC Against Y. enterocolitica (μg/mL)Cytotoxicity CC₅₀ (μM)
YZ-270.85 ± 0.12>100>1184>200
YZ-311.24 ± 0.1875.3 ± 8.660.78165 ± 12
YZ-420.37 ± 0.0812.8 ± 1.534.6287 ± 9
YZ-562.15 ± 0.25>100>46.516>200

This approach would identify compounds that specifically target bacterial YedZ/MsrQ while minimizing effects on human NOX proteins, potentially leading to novel antibiotics with a unique mechanism of action and reduced likelihood of existing resistance mechanisms .

What are the main challenges in studying YedZ (MsrQ) function in Yersinia enterocolitica, and how can they be overcome?

Studying YedZ/MsrQ function in Y. enterocolitica presents several technical challenges due to its nature as a membrane protein with complex cofactor requirements and involvement in oxidative stress pathways. The following methodological solutions address these challenges:

  • Challenge: Membrane protein expression and purification

    • Solution: Optimize expression using specialized vectors designed for membrane proteins, such as those with tunable promoters allowing low-level expression. Utilize fusion partners like GFP to monitor expression and folding. Screen multiple detergents for solubilization, considering newer amphipols or nanodiscs for maintaining native-like membrane environments .

  • Challenge: Maintaining heme incorporation during recombinant expression

    • Solution: Supplement expression media with δ-aminolevulinic acid and iron sources. Consider co-expression with heme biosynthesis enzymes or heme transport proteins. Express at lower temperatures (16°C) with extended induction times to allow proper cofactor incorporation .

  • Challenge: Assessing electron transfer in a membrane-bound system

    • Solution: Develop reconstituted proteoliposome systems containing purified YedZ/MsrQ and its redox partners. Use rapid kinetic techniques like stopped-flow spectroscopy with diode array detection to follow multiple spectral changes simultaneously. Apply electrochemical methods like protein film voltammetry to directly measure electron transfer properties.

  • Challenge: Distinguishing YedZ/MsrQ function from other oxidative stress response systems

    • Solution: Create targeted gene deletions using CRISPR-Cas9 or allelic exchange techniques. Generate multiple mutants lacking different combinations of oxidative stress response genes to identify functional redundancy. Use complementation with site-specific variants to evaluate the importance of specific residues.

  • Challenge: Relevance of in vitro findings to in vivo infection

    • Solution: Develop animal models that specifically challenge the oxidative stress response system. Create reporter strains that allow monitoring of YedZ/MsrQ activity in vivo during infection. Use tissue-specific sampling and single-cell technologies to assess bacterial responses in different host microenvironments.

A data table comparing the effectiveness of different approaches for studying YedZ/MsrQ might include:

Methodological ApproachKey AdvantagesLimitationsBest Applications
Whole-cell assaysMaintains native context, Allows screening of multiple conditionsIndirect measurement of YedZ function, Confounded by redundant systemsInitial phenotypic characterization, High-throughput screening
Membrane vesiclesPreserves membrane environment, Relatively simple preparationLimited control of components, Heterogeneous preparationElectron transport coupling studies, Substrate specificity assessment
Purified protein reconstitutionDefined components, Direct measurement of activityLoss of native interactions, Technical complexityDetailed mechanistic studies, Inhibitor binding analysis
In vivo imagingDirect visualization in infection context, Spatial resolutionTechnical challenges, Limited quantitative capacityHost-pathogen interaction studies, Tissue-specific responses

By combining these approaches, researchers can overcome the inherent challenges in studying membrane-bound redox systems like YedZ/MsrQ and gain comprehensive insights into their function in bacterial pathogenesis .

How can researchers effectively design experiments to investigate potential redundancy between YedZ (MsrQ) and other oxidative stress response systems in Y. enterocolitica?

Investigating functional redundancy between different oxidative stress response systems requires careful experimental design to delineate unique and overlapping functions. For YedZ/MsrQ in Y. enterocolitica, consider the following experimental approach:

  • Systematic gene deletion analysis:

    • Create single, double, and multiple deletion mutants of YedZ/MsrQ and other oxidative stress response genes (katG, sodA, sodB, ahpC, etc.)

    • Compare growth and survival under various oxidative stress conditions (H₂O₂, superoxide, HOCl, peroxynitrite)

    • Quantify the degree of synthetic lethality or enhanced sensitivity in multiple mutants to identify redundant systems

  • Transcriptomic and proteomic profiling:

    • Analyze changes in gene expression and protein levels in ΔyedZ mutants under normal and stress conditions

    • Identify compensatory upregulation of other stress response systems

    • Use time-course analyses to track the sequence of adaptive responses following deletion

  • Substrate specificity determination:

    • Develop assays to measure repair of specific oxidized substrates (different methionine-containing periplasmic proteins)

    • Compare substrate profiles between YedZ/MsrQ and other repair systems

    • Use mass spectrometry to identify and quantify specific oxidative modifications

  • Compartment-specific oxidative stress:

    • Deploy oxidizing agents with different subcellular targeting (membrane-permeable vs. impermeable)

    • Use genetically encoded, compartment-specific redox sensors to monitor localized oxidative stress

    • Correlate compartment-specific damage with system-specific protection

  • In vivo infection models with specific ROS challenges:

    • Use neutrophil-deficient mouse models to reduce specific types of oxidative challenge

    • Compare wild-type and mutant strains in models with genetic deficiencies in host ROS production

    • Quantify bacterial survival in specific tissues with varying oxidative environments

A typical experimental design matrix might look like:

Oxidative Stress ConditionStrain Genotypes to CompareReadoutsExpected Outcomes for Redundant Systems
H₂O₂ (0.1-10 mM)WT, ΔyedZ, ΔkatG, ΔyedZ ΔkatGGrowth rate, Survival percentage, Protein carbonylationMinimal effect in single mutants, Synergistic sensitivity in double mutant
HOCl (10-100 μM)WT, ΔyedZ, ΔahpC, ΔyedZ ΔahpCSurvival percentage, Methionine oxidation, Redox proteomic profileSignificant effect in ΔyedZ, Enhanced effect in double mutant
Neutrophil co-cultureWT, ΔyedZ, ΔsodAB, ΔyedZ ΔsodABIntracellular survival, ROS-dependent killing, Gene expression profileSystem-specific sensitivity based on predominant ROS type
Mouse infectionWT, ΔyedZ, Δ(redundant system), Double mutantOrgan bacterial burden, Inflammatory markers, In vivo gene expressionTissue-specific effects based on local oxidative environment

This comprehensive approach would allow researchers to precisely map the functional relationships between YedZ/MsrQ and other oxidative stress response systems, identifying unique and shared roles in bacterial survival and pathogenesis .

What are the emerging approaches for targeting YedZ (MsrQ) function to develop novel antimicrobial strategies against Yersinia enterocolitica?

As antibiotic resistance continues to emerge as a global health challenge, developing novel antimicrobial strategies targeting previously unexplored bacterial systems becomes increasingly important. YedZ/MsrQ represents an attractive target due to its role in oxidative stress defense and virulence. Several emerging approaches show promise:

  • Small molecule inhibitors of heme binding:

    • Design compounds that interfere with the incorporation of heme cofactors essential for YedZ/MsrQ function

    • Develop high-throughput screening assays using purified protein or whole cells with reporter systems to identify molecules that disrupt heme coordination

    • Optimize lead compounds using medicinal chemistry to enhance selectivity for bacterial YedZ/MsrQ over mammalian hemoproteins

  • Peptide inhibitors of protein-protein interactions:

    • Identify the specific interaction interfaces between YedZ/MsrQ and its redox partners (MsrP and electron donors like Fre)

    • Design peptide mimetics that competitively bind these interfaces and disrupt electron transfer

    • Develop cell-penetrating versions that can reach the periplasmic space and cytoplasmic membrane

  • Adjuvant therapy approach:

    • Develop compounds that don't kill bacteria directly but sensitize them to oxidative killing by host immune cells

    • Combine YedZ/MsrQ inhibitors with existing antibiotics to enhance efficacy against resistant strains

    • Evaluate synergistic effects with neutrophil-derived antimicrobial peptides

  • Nanoparticle-based delivery systems:

    • Engineer nanoparticles to selectively deliver inhibitory compounds to bacterial membranes

    • Develop stimuli-responsive delivery systems that release inhibitors in response to the local environment of infection sites

    • Combine targeting moieties with therapeutic payloads to enhance selectivity for Yersinia species

  • CRISPR-Cas antimicrobials:

    • Design CRISPR-Cas delivery systems targeting the yedZ gene

    • Develop phage-based delivery methods for CRISPR-Cas components specific to Yersinia species

    • Evaluate the effectiveness and resistance development in in vitro and in vivo models

The potential impact of these approaches could be assessed using a framework like:

Antimicrobial ApproachEstimated Timeline to DevelopmentPotential AdvantagesTechnical ChallengesResistance Development Risk
Small molecule inhibitors3-5 yearsTraditional drug development pathway, Oral bioavailabilityAchieving selectivity, Membrane penetrationModerate (target modification)
Peptide inhibitors2-4 yearsHigh specificity, Novel mechanismStability in vivo, Delivery to site of actionLow-Moderate (bypass mechanisms)
Adjuvant therapy1-3 yearsEnhances existing treatments, May restore sensitivityTiming of administration, Complex pharmacodynamicsLow (multiple targets)
Nanoparticle delivery4-6 yearsTargeted delivery, Multiple payload capacityManufacturing complexity, Regulatory pathwayLow (physical targeting)
CRISPR-Cas systems5-7 yearsExtreme specificity, Limited off-target effectsDelivery challenges, Immune responseLow (requires multiple mutations)

These emerging approaches represent the frontier of antimicrobial development targeting YedZ/MsrQ, potentially leading to novel therapeutic strategies against Y. enterocolitica and other pathogenic bacteria with similar systems .

How might high-throughput screening approaches be optimized to identify inhibitors of YedZ (MsrQ) function in Yersinia enterocolitica?

Developing effective high-throughput screening (HTS) approaches for YedZ/MsrQ inhibitors requires careful consideration of assay design, compound libraries, and validation strategies. The following methodological framework outlines an optimized approach:

  • Primary screening assay development:

    • Design a whole-cell reporter system in Y. enterocolitica where YedZ/MsrQ activity is linked to fluorescent or luminescent output

    • Engineer strains with promoter-reporter fusions (e.g., PmsrP-GFP) that respond to oxidative stress and require functional YedZ/MsrQ

    • Develop biochemical assays measuring electron transfer from NADPH through Fre and YedZ/MsrQ to an artificial electron acceptor

  • Compound library selection and screening:

    • Screen diverse chemical libraries including natural products, known redox-active compounds, and structural analogs of heme

    • Include compound collections enriched for membrane-targeting molecules and those with activity against related enzyme systems

    • Implement a tiered screening approach with increasing stringency and specificity at each stage

  • Advanced validation approaches:

    • Confirm target engagement using thermal shift assays with purified YedZ/MsrQ

    • Employ surface plasmon resonance to quantify binding kinetics and affinity

    • Validate mechanism of action using spectroscopic techniques to monitor heme redox state

    • Assess effects on protein-protein interactions between YedZ/MsrQ and its partners

  • Counterscreening strategy:

    • Test activity against human NOX enzymes to identify compounds with selectivity for bacterial targets

    • Evaluate general cytotoxicity against mammalian cell lines

    • Assess activity against Y. enterocolitica strains with YedZ/MsrQ mutations to confirm target specificity

A typical screening cascade might be structured as:

Screening PhaseAssay TypeThroughputCriteria for AdvancementExpected Hit Rate
Primary ScreenWhole-cell reporter assay100,000 compounds/week>50% inhibition at 10 μM0.5-1%
ConfirmationDose-response in reporter assay500-1,000 compoundsIC₅₀ <5 μM, Hill slope 0.8-1.250-70% of primary hits
Secondary ScreenPurified protein activity assay250-500 compounds>50% inhibition at 5 μM30-50% of confirmed hits
Tertiary ScreenTarget engagement assays75-150 compoundsDemonstrable binding to YedZ/MsrQ50-70% of secondary hits
CounterscreenHuman NOX activity, Cytotoxicity40-100 compoundsSelectivity index >1030-50% of tertiary hits
Lead ValidationMultiple mechanistic assays10-30 compoundsConsistent MoA, Activity in infection models20-40% of counterscreened hits

Potential challenges and solutions in the optimization process include:

  • Challenge: Membrane protein assay stability

    • Solution: Develop stabilized forms of YedZ/MsrQ through protein engineering or optimized detergent/lipid compositions

  • Challenge: Distinguishing direct inhibitors from compounds affecting upstream or downstream processes

    • Solution: Implement orthogonal assays measuring different aspects of YedZ/MsrQ function

  • Challenge: Compound aggregation leading to false positives

    • Solution: Include detergent in screening buffers and implement aggregation counterscreens

This comprehensive approach would maximize the probability of identifying selective inhibitors of YedZ/MsrQ with potential for development into novel antimicrobial agents .

How does the current understanding of YedZ (MsrQ) function in Yersinia enterocolitica inform broader bacterial adaptation mechanisms to oxidative stress?

The characterization of YedZ/MsrQ as part of the MsrPQ system in Yersinia enterocolitica provides significant insights into broader bacterial adaptation mechanisms to oxidative stress. This system represents a specialized defense mechanism focused on periplasmic protein repair, complementing other known oxidative stress response systems that primarily protect cytoplasmic components .

Several key principles emerge from current research on YedZ/MsrQ that inform our understanding of bacterial adaptation to oxidative stress:

  • Compartmentalization of oxidative stress responses: The MsrPQ system exemplifies how bacteria have evolved compartment-specific defense mechanisms. While cytoplasmic oxidative stress is managed by well-characterized systems like SoxRS and OxyR regulons, the periplasm requires distinct mechanisms due to its direct exposure to host-derived oxidants. This compartmentalization allows bacteria to efficiently allocate resources based on the specific challenges in each cellular location .

  • Evolution of specialized repair systems: The MsrPQ system demonstrates how bacteria have developed targeted repair mechanisms for specific types of oxidative damage. Rather than preventing all forms of oxidation, bacteria maintain multiple specialized systems that address different modifications. This specialization likely offers greater efficiency in managing the diverse forms of oxidative damage encountered during host infection .

  • Conservation and diversity across species: Comparative analysis of YedZ/MsrQ across Yersinia species and other bacteria reveals both conserved functional domains and species-specific adaptations. This pattern suggests a core mechanism that has been fine-tuned to the specific ecological niches and lifestyles of different bacterial species. The varying importance of YedZ/MsrQ in different Yersinia phylogroups likely reflects their distinct evolutionary trajectories and host adaptation strategies .

  • Integration with electron transport networks: The identification of YedZ/MsrQ as a component related to eukaryotic NADPH oxidase systems highlights how bacteria have evolved to integrate oxidative stress responses with cellular electron transport networks. This integration allows for efficient coupling of reducing power generation with antioxidant functions, suggesting a metabolic regulation of defense capabilities .

  • Repurposing of protein domains: The structural similarities between YedZ/MsrQ and components of eukaryotic NOX enzymes suggest evolutionary repurposing of protein domains for different functions—generating ROS in eukaryotes versus defending against ROS in bacteria. This repurposing demonstrates the versatility of certain protein architectures in mediating electron transfer reactions across biological kingdoms .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.