Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC)
Description
General Information
Yersinia enterocolitica is a bacterium that causes a variety of clinical and immunological manifestations in humans, mainly through contaminated food or water . This species has seven biotypes (1A, 1B, 2, 3, 4, 5, and 6) and more than 60 serotypes, with certain serotypes (O3; O5,27; O8; and O9) being more prevalent in human isolates . Y. enterocolitica includes strains with varying degrees of pathogenicity: nonpathogenic (biotype 1A), weakly pathogenic (biotypes 2 to 6), and highly pathogenic strains (biotype 1B) . The high pathogenicity of biotype 1B is linked to the yersiniabactin siderophore-mediated iron uptake system .
Recombinant Full Length Yersinia enterocolitica serotype O:8 / biotype 1B Undecaprenyl-Phosphate 4-Deoxy-4-Formamido-L-Arabinose Transferase(Arnc) Protein, His-Tagged is a protein expressed in E. coli .
Table: Recombinant Full Length Yersinia enterocolitica serotype O:8 / biotype 1B Undecaprenyl-Phosphate 4-Deoxy-4-Formamido-L-Arabinose Transferase(Arnc) Protein, His-Tagged
| Category | Information |
|---|---|
| Catalog Number | RFL20058YF |
| Species | Yersinia enterocolitica |
| Source | E. coli |
| Tag | His |
| Protein Length | Full Length (1-327) |
| Form | Lyophilized powder |
| AA Sequence | MSESEKIKKVSIVIPVYNEQESLPILIERTSAACKLLTQPYEIILVDDGSSDNSAELLTA AANEPESHIIAVLLNRNYGQHSAIMAGFNQVSGDLIITLDADLQNPPEEIPRLVSVAEEG YDVVGTVRAHRQDSLFRKTASRMINMMIQRATGKSMGDYGCMLRAYRRHIVEAMLHCHER STFIPILANTFARRTTEITVHHAEREFGDSKYSLMKLINLMYDLITCLTTTPLRLLSLVG SVIALSGFTLAVLLVVLRLVFGPEWAGGGVFTLFAVLFMFIGAQFVGMGLLGEYIGRIYN DVRARPRYFIQKVVGAEQTENNQEVEK |
| Purity | Greater than 90% as determined by SDS-PAGE |
| Storage | Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles. |
| Storage Buffer | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Addition of 5-50% glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃ is recommended. |
| Gene Name | arnC |
| Synonyms | arnC; YE2191; Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase; Undecaprenyl-phosphate Ara4FN transferase; Ara4FN transferase |
| UniProt ID | A1JPP5 |
Function and Role of arnC
The arnC gene encodes Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase, also known as Ara4FN transferase . This enzyme is involved in the biosynthesis of lipid A, a component of lipopolysaccharide (LPS) in Yersinia enterocolitica . LPS is a major constituent of the outer membrane of Gram-negative bacteria and plays a crucial role in the bacteria's resistance to antimicrobial peptides and other environmental factors .
Virulence and Pathogenicity
Yersinia enterocolitica biotype 1B strains are highly pathogenic, and their virulence is associated with specific genes and pathways . The arnC gene and its product, Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase, contribute to the modification of lipid A, which can affect the bacterium's resistance to antimicrobial peptides . Modification of lipid A can alter the charge and structure of the bacterial surface, reducing the binding and activity of antimicrobial peptides .
Molecular Characterization
Molecular characterization of Y. enterocolitica isolates is important for understanding their epidemiology and virulence . Techniques such as pulsed-field gel electrophoresis (PFGE) are used to analyze the genetic relatedness of different isolates . The presence and expression of virulence genes, including those involved in LPS biosynthesis, are also examined to determine the pathogenic potential of the bacteria .
Product Specs
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Target Background
This enzyme catalyzes the transfer of 4-deoxy-4-formamido-L-arabinose from UDP to undecaprenyl phosphate. The modified arabinose is incorporated into lipid A, contributing to resistance against polymyxin and cationic antimicrobial peptides.
KEGG: yen:YE2191
STRING: 393305.YE2191
