Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Universal stress protein B (uspB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we will prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on shipping method and location. Contact your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipments.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If a specific tag is required, please inform us, and we will prioritize its inclusion.
Synonyms
uspB; YE4049; Universal stress protein B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Target Names
uspB
Target Protein Sequence
MISTVALFWALCVVCVINMARYYSSLRALLVVLRGCDPLLYQYVDGGGFFTSHGQPSKQI RLVGYIFAQRYLDHHDPEFIRRCERLRGQFILTSALCGLVMVSLVGLILWY
Uniprot No.

Target Background

Database Links

KEGG: yen:YE4049

STRING: 393305.YE4049

Protein Families
Universal stress protein B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Yersinia enterocolitica and why is it studied in microbiology research?

Yersinia enterocolitica is a Gram-negative bacillus-shaped bacterium belonging to the Enterobacteriaceae family. It causes yersiniosis, a zoonotic disease affecting both humans and various animals including cattle, deer, and pigs . The bacterium is particularly important in research because it is widespread in nature, occurring in intestinal tracts of mammals, birds, and cold-blooded species, as well as in terrestrial and aquatic niches .

While most environmental isolates are avirulent, certain strains—particularly bioserotype 1B/O:8—are highly pathogenic and represent significant public health concerns. The epidemiology of Y. enterocolitica infections remains complex and poorly understood, with many sporadic cases reported without apparent sources . This bacterium has also emerged as a growing concern due to increasing prevalence and multidrug resistance patterns .

What are Universal Stress Proteins (USPs) and what is their function in bacterial physiology?

Universal Stress Proteins (USPs) constitute a conserved family of proteins that are upregulated under various stress conditions in bacteria. These proteins are generally expressed during both stationary phase and exponential growth phase under stress conditions . USPs have been extensively studied in various bacteria including Escherichia coli, Salmonella typhimurium, Mycobacterium tuberculosis, Pseudomonas aeruginosa, and Lactobacillus plantarum .

The expression of USPs is typically associated with the arrest of cellular growth in response to prolonged stress . Research in multiple bacterial species has demonstrated that USP deletion mutants show significantly reduced survival compared to wild-type strains when exposed to various stressors, suggesting these proteins play critical roles in bacterial stress adaptation mechanisms .

Structurally, USPs typically present a Rossmann-like α/β-fold with five parallel β-strands surrounded by four α-helices. This structure can form homo-dimers or homo-tetramers depending on the specific USP and bacterial species .

How is recombinant Y. enterocolitica uspB typically produced for research purposes?

Recombinant Y. enterocolitica Universal Stress Protein B can be produced using similar approaches to those employed for other recombinant proteins from this organism. Typical expression systems include E. coli, yeast, baculovirus, or mammalian cell-based platforms . For optimal production of functional protein:

  • The gene encoding uspB is first isolated from Y. enterocolitica serotype O:8 / biotype 1B and amplified using PCR with specific primers.

  • The amplified gene is then cloned into an appropriate expression vector, such as pET-28a, which has been successfully used for expression of other Yersinia proteins .

  • Expression is typically optimized through codon optimization based on the codon usage bias of the expression host, most commonly E. coli .

  • Following expression, the recombinant protein is purified using affinity chromatography, taking advantage of fusion tags such as His-tags that may be incorporated into the expression construct.

  • Proper folding and activity are verified through structural and functional assays.

What are the typical structural characteristics of USPs in pathogenic bacteria?

USPs in pathogenic bacteria typically share several conserved structural features:

These structural features are based on analyses of USPs from various bacteria . The highly conserved folding regions, especially those represented by β-strands, contain residues with hydrophobic properties that play important roles in protein folding and stability. These regions are crucial in forming a stable β-sheet that has been described as a typical USP molecular core .

How does expression of uspB change under different stress conditions, and what techniques are optimal for measuring these changes?

Based on research with USPs in related bacteria, uspB expression in Y. enterocolitica likely responds dynamically to various environmental stressors. To effectively measure these expression changes, several complementary approaches are recommended:

  • Quantitative RT-PCR: This represents the gold standard for measuring changes in gene expression. Using primers specific to Y. enterocolitica uspB, researchers can quantify transcript levels under various conditions such as acid stress, oxidative stress, nutrient limitation, or temperature shifts.

  • Proteomic Analysis: Two-dimensional gel electrophoresis coupled with mass spectrometry can detect changes in USP protein levels. When applying this technique to USP analysis in Listeria, researchers successfully identified upregulation under acid stress conditions .

  • Reporter Gene Fusions: Creating transcriptional fusions between the uspB promoter and reporter genes (such as gfp or lux) enables real-time monitoring of gene expression in living cells.

  • In vivo Expression Technology (IVET): This approach has been successfully used to identify genes in Y. enterocolitica that are specifically expressed during systemic infection . A similar strategy could be employed to study uspB expression in different host environments.

Based on studies with other USPs, researchers should anticipate that uspB expression in Y. enterocolitica may be significantly upregulated under conditions including acid stress, oxidative stress, nutrient starvation, and during stationary phase growth .

What methodological approaches can be used to characterize the function of uspB in Y. enterocolitica pathogenesis?

To investigate the role of uspB in Y. enterocolitica pathogenesis, researchers should consider a multifaceted approach:

  • Gene Knockout Studies: Creating a uspB deletion mutant using homologous recombination or CRISPR-Cas9 technology enables direct assessment of the protein's contribution to stress resistance and virulence. Similar approaches with other USPs have revealed their roles in bacterial survival under stress conditions .

  • Complementation Assays: Reintroducing the uspB gene on a plasmid into the knockout mutant should restore the wild-type phenotype, confirming that observed effects are specifically due to uspB deletion.

  • Animal Infection Models: Using the wild-type and uspB mutant strains in mouse models of infection can help assess the contribution of uspB to colonization, persistence, and pathology. The BALB/c mouse model has been successfully used for studying Y. enterocolitica virulence factors .

  • Stress Challenge Assays: Exposing wild-type and uspB mutant strains to various stressors (acid, oxidative stress, antimicrobials) and measuring survival can elucidate the specific stress responses mediated by uspB.

  • Transcriptomic Analysis: RNA-seq comparing wild-type and uspB mutant strains under various conditions can identify genes and pathways regulated by uspB, providing insights into its broader cellular functions.

  • Protein-Protein Interaction Studies: Techniques such as bacterial two-hybrid assays or co-immunoprecipitation can identify proteins that interact with uspB, illuminating its role in protein networks involved in stress response and virulence.

How can structural analysis of uspB inform the development of antimicrobials targeting Y. enterocolitica?

Structural analysis of uspB provides valuable insights for antimicrobial development through several approaches:

This structural approach has been successfully applied in developing a multi-epitope vaccine for Y. enterocolitica targeting other conserved proteins , suggesting similar strategies could be effective for uspB-targeted therapeutics.

What is the role of uspB in Y. enterocolitica biofilm formation and stress adaptation?

While direct evidence specific to uspB in Y. enterocolitica is limited, research on USPs in other bacteria suggests several probable roles:

  • Biofilm Formation: USPs likely influence biofilm formation through:

    • Regulation of extracellular polysaccharide production

    • Modification of cell surface properties affecting initial attachment

    • Influence on quorum sensing systems regulating biofilm maturation

    • Protection of cells within biofilms from environmental stressors

  • Stress Adaptation Mechanisms: Based on roles demonstrated for USPs in other bacteria, uspB likely contributes to:

    • Acid tolerance response, particularly relevant for gastrointestinal survival

    • Oxidative stress resistance, crucial during host immune response encounters

    • Adaptation to nutrient limitation during infection

    • Temperature stress response during host-pathogen transitions

  • Persister Cell Formation: USPs have been implicated in bacterial persistence, a phenotypic state characterized by metabolic dormancy and extreme stress tolerance. This may be particularly relevant for chronic or recurrent Y. enterocolitica infections.

Experimental approaches to investigate these potential roles include biofilm quantification assays comparing wild-type and uspB mutant strains, microscopic analysis of biofilm architecture, and stress survival assays under conditions mimicking host environments.

What challenges exist in developing vaccines targeting USPs in Y. enterocolitica?

Development of vaccines targeting USPs in Y. enterocolitica faces several significant challenges:

  • Antigenic Variation: While the core structure of USPs is conserved, surface-exposed regions may vary between strains and serotypes, potentially limiting cross-protection.

  • Expression Conditions: USPs are typically upregulated under stress conditions, making it challenging to ensure sufficient expression of these targets during vaccine production.

  • Immunogenicity Concerns: As stress proteins, USPs may not naturally elicit strong adaptive immune responses during infection, potentially requiring advanced adjuvant strategies.

  • Epitope Selection: Identifying immunogenic epitopes that stimulate both humoral and cell-mediated immunity requires sophisticated epitope mapping approaches. Recent in silico approaches have successfully identified B-cell, MHC class I, and MHC class II epitopes for other Y. enterocolitica proteins, providing a template for USP analysis .

  • Delivery and Formulation: Ensuring stability and appropriate delivery of USP-based vaccine components requires careful optimization.

Recent advances in multi-epitope vaccine design for Y. enterocolitica demonstrate promising approaches to overcome these challenges. For example, a recent study employed:

  • TLR4 agonists as adjuvants to enhance immunogenic response

  • EAAAK, CPGPG, and AYY linkers to construct stable vaccine formulations

  • Extensive computational evaluations to predict physicochemical properties

  • Population coverage analysis estimating vaccine applicability across diverse populations (99.74% coverage achieved)

These approaches provide a foundation for developing uspB-targeted vaccine components.

What are the most promising future research directions for Y. enterocolitica uspB studies?

Future research on Y. enterocolitica uspB should focus on several promising directions:

  • Comparative Genomics: Analyzing uspB sequence conservation and variation across Y. enterocolitica strains with different virulence profiles could identify correlations between uspB variants and pathogenicity.

  • Systems Biology Approaches: Integrating transcriptomic, proteomic, and metabolomic data from wild-type and uspB mutant strains could reveal the broader impact of uspB on cellular networks.

  • Host-Pathogen Interaction Studies: Investigating how uspB affects interactions with host immune cells and epithelial surfaces could uncover its role in immune evasion and colonization.

  • Structure-Function Relationships: Detailed analysis of uspB structure through X-ray crystallography or cryo-EM would provide definitive structural data to complement computational models, advancing structure-based drug design efforts.

  • Combination Therapy Strategies: Exploring synergistic effects between uspB inhibitors and conventional antibiotics could lead to more effective treatment strategies for multidrug-resistant Y. enterocolitica infections.

  • In Vivo Expression Dynamics: Developing reporter systems to monitor uspB expression during different phases of infection could provide insights into its temporal importance during pathogenesis.

These research directions will contribute to a more comprehensive understanding of uspB's role in Y. enterocolitica biology and pathogenesis, potentially leading to new diagnostic, therapeutic, and preventive strategies for yersiniosis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.