Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B UPF0283 membrane protein YE2117 (YE2117)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
YE2117; UPF0283 membrane protein YE2117
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-354
Protein Length
full length protein
Species
Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Target Names
YE2117
Target Protein Sequence
MSEPLKPRIDFEQPLQPIDEPVLKAAQAFDQHAAENFYPADPELDAENEEGRVEGLVNAA LKPKRSLWRKMVTVGIALFGVSVIAQSVQWVNQAWQQQDWIALGATTAGGLIVLAGVGSV VTEWRRLYRLRQRAEERDIARELLVSHGIGQGRAFCEKLARQAGLDQGHPALQRWQASLH ETHNDREVVELYAKLVQPSLDNLARAEISRYAAESALMIAVSPLALVDMAFIAWRNIRLI NRIAALYGIELGYFSRIRLFRLVLLNIAFAGASELVREVGMDWLSQDLAARLSARAAQGI GAGLLTARLGIKAMELCRPLPWLGDDKPKLGDFRRQLIGQLKNTLPKKDKPAQQ
Uniprot No.

Target Background

Database Links

KEGG: yen:YE2117

STRING: 393305.YE2117

Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Which expression systems are most suitable for producing recombinant YE2117?

Several expression systems can be used for producing recombinant YE2117, with varying advantages:

Expression SystemYieldTurnaround TimePost-translational ModificationsRecommended Use
E. coliHighShortMinimalBasic structural studies
YeastHighShortModerateFunctional studies requiring some modifications
Insect cellsModerateModerateExtensiveStudies requiring proper protein folding
Mammalian cellsLowLongCompleteActivity-dependent studies

What storage conditions optimize YE2117 stability after purification?

For optimal stability of purified recombinant YE2117:

  • Store the protein at -20°C for regular storage

  • For extended storage, conserve at -20°C or -80°C

  • Use a Tris-based buffer with 50% glycerol, optimized for this specific protein

  • Avoid repeated freezing and thawing cycles as this can degrade the protein

  • Working aliquots can be stored at 4°C for up to one week

These conditions help maintain protein integrity and functional activity for experimental use.

How can epitope tagging strategies be optimized for structural studies of YE2117?

When designing epitope tagging strategies for YE2117 structural studies, researchers should consider:

The N-terminal transmembrane-helix epitope tag approach is particularly effective for YE2117 and similar membrane proteins. This method involves identifying a helical epitope (such as from the membrane-proximal external region of HIV gp41) that can be fused as a contiguous extension of the N-terminal transmembrane helix .

For YE2117 specifically, this approach provides several advantages:

  • Creates a structurally defined, rigid docking site for antibody fragments

  • Transferable among diverse membrane proteins including YE2117

  • Can be engineered without prior structural information

  • Enables effective crystallization by acting as a chaperone

  • Serves as an electron microscopy fiducial marker

This strategy is particularly valuable for YE2117 as a small membrane protein, which typically presents experimental challenges for structural studies. The epitope tag provides a stable interaction point for antibody fragments that facilitate both crystallization and electron microscopy studies .

What are the dynamics of YE2117 within bacterial membranes and how can they be studied?

YE2117, like other membrane proteins, likely exists in dynamic clusters within the bacterial membrane. These dynamics can be studied using several advanced techniques:

  • Fluorescence Resonance Energy Transfer (FRET) - Measures direct protein-protein interactions and small-scale associations of YE2117 within the membrane

  • Scanning Near-field Optical Microscopy (SNOM) - Identifies large protein clusters (several hundred nanometers in diameter) containing YE2117

  • Confocal microscopy - Allows visualization of clusters on non-fixed, non-dehydrated cells

  • Photobleaching FRET approach - Determines FRET efficiency characterizing small-scale clustering

Research suggests that membrane protein clusters like YE2117 may have dynamic compositions, with proteins exchanging between clusters through association-dissociation events . Temperature-dependent experiments have shown that:

  • At 37°C: Dynamic exchange of components between clusters occurs

  • At 4°C (on ice): Minimal protein redistribution, indicating that dynamic composition depends on membrane diffusion

For YE2117 specifically, researchers should consider using brefeldin A, monensin, or aluminum fluoride (AlF3) to block protein internalization and ensure measurements reflect membrane-bound processes, not endocytosis-mediated recycling .

How can YE2117 be incorporated into vaccine development strategies against Yersinia enterocolitica?

YE2117 could potentially be incorporated into vaccine development following strategies similar to those used with other Yersinia proteins:

Bivalent fusion protein approaches have proven successful with other Yersinia membrane proteins. For example, the rVE fusion protein comprising immunologically active regions of Y. pestis LcrV (100-270 aa) and YopE (50-213 aa) has shown complete protection against lethal Y. enterocolitica challenge .

For YE2117-based vaccine development, researchers should consider:

  • Identifying immunogenic epitopes - Map regions of YE2117 that elicit strong immune responses

  • Creating fusion constructs - Generate recombinant proteins combining YE2117 with known immunogenic proteins

  • Balancing immune responses - Design constructs that activate both humoral and cell-mediated immunity

Success metrics from similar approaches show that effective vaccines induce:

  • Proliferation of both CD4+ and CD8+ T cell subsets

  • High antibody titers with balanced IgG1:IgG2a/IgG2b isotypes (optimal ratio ~1:1)

  • Upregulation of both Th1 (TNF-α, IFN-γ, IL-2, IL-12) and Th2 (IL-4) cytokines

In animal models, successful fusion protein vaccines have demonstrated 100% protection rates compared to lower rates (25-37.5%) with single-component immunizations when challenged with Y. enterocolitica .

What approaches can overcome challenges in crystallizing YE2117 for structural determination?

Crystallizing membrane proteins like YE2117 presents significant challenges due to their hydrophobic nature and structural complexity. Several strategies can improve success rates:

  • Antibody fragment complexation - Using the N-terminal transmembrane-helix epitope tag approach allows for complexation with monoclonal antibody fragments, serving as crystallization chaperones

  • Lipidic cubic phase crystallization - This method maintains the membrane protein in a lipid environment, potentially improving crystal formation

  • Detergent screening - Systematic testing of different detergents for solubilization and crystallization:

Detergent ClassExamplesBenefits for YE2117 Crystallization
MaltosidesDDM, UDMGood for initial solubilization
GlucosidesOG, NGOften effective for crystallization
Facial amphiphilesCHAPS, CHAPSOMaintain native protein state
Neopentyl glycolsLMNG, MNG-3Enhanced stability during purification
  • Fusion protein approaches - Creating fusion constructs with crystallization-prone proteins like T4 lysozyme or BRIL can enhance crystallizability

  • Surface entropy reduction - Mutating surface residues with high conformational entropy to alanine may promote crystal contacts

These approaches have been successful for crystallizing challenging membrane proteins similar to YE2117 and can be adapted to the specific properties of this protein .

How does YE2117 contribute to Yersinia enterocolitica pathogenesis and host immune evasion?

While the specific role of YE2117 in pathogenesis is not fully characterized, inferences can be made from studies of Yersinia enterocolitica infection mechanisms:

Y. enterocolitica invades Peyer's patches, disseminates to lymphoid tissues, and induces mucosal and systemic immune responses . As a membrane protein, YE2117 may contribute to:

  • Bacterial adhesion and invasion - Potential role in attachment to host cells or tissues

  • Immune evasion - Possible contribution to subversion of host immune responses

  • Membrane integrity - Maintenance of bacterial membrane structure during host colonization

Understanding YE2117's role in pathogenesis requires experimental approaches such as:

  • Generation of YE2117 knockout strains and virulence assessment

  • Host cell interaction studies with wildtype vs. mutant strains

  • Immunological profiling of host responses to YE2117

Studies of other Yersinia virulence factors have shown they act on host cells involved in both innate and adaptive immunity . Investigating whether YE2117 interacts with these pathways would provide insights into its potential role in virulence.

What genomic variation exists in YE2117 across Yersinia enterocolitica isolates?

Genomic surveillance of Y. enterocolitica isolates can reveal important variations in YE2117 across different strains:

Recent genomic characterization of 78 Y. enterocolitica isolates from Costa Rica revealed that:

  • Most isolates (76/78) belonged to genotype 4

  • Two isolates belonged to genotype 2/3-5a

A comprehensive analysis of YE2117 sequence variations would require:

  • Whole genome sequencing of diverse isolates

  • Comparative genomic analysis focusing on the YE2117 locus

  • Assessment of selection pressures using dN/dS ratios

  • Correlation of sequence variations with functional differences

  • Conserved regions essential for protein function

  • Variable regions potentially involved in host adaptation

  • Evolutionary patterns suggesting functional importance

Such information would be valuable for understanding YE2117's biological significance and its potential as a diagnostic or therapeutic target.

What are the optimal purification strategies for obtaining high-quality YE2117 for functional studies?

Purification of membrane proteins like YE2117 requires specialized approaches:

Purification StepRecommended MethodCritical Parameters
Cell lysisMechanical disruption or detergent solubilizationBuffer composition, temperature control
Membrane isolationDifferential centrifugationCentrifugation speed and duration
SolubilizationDetergent screening (DDM, LMNG recommended initially)Detergent concentration, solubilization time
Affinity purificationHis-tag affinity chromatographyImidazole concentration gradient
Size exclusionSuperdex 200 or similarFlow rate, buffer composition

For YE2117 specifically:

  • Express with a His-tag to facilitate purification

  • Use Tris-based buffer systems optimized for this protein

  • Include 50% glycerol in storage buffers to maintain stability

  • Verify protein quality using SDS-PAGE and Western blotting

  • Assess functional integrity through appropriate activity assays

These methods maximize protein yield while maintaining structural integrity and functional activity.

How can researchers effectively study YE2117 interactions with host immune components?

To study YE2117 interactions with host immune components, researchers can employ several methodologies:

  • T-cell proliferation assays - To assess if YE2117 stimulates CD4+ and/or CD8+ T cell proliferation:

    • Isolate splenocytes from immunized mice

    • Expose to recombinant YE2117

    • Measure proliferation using techniques like CFSE dilution or 3H-thymidine incorporation

    • Compare with control proteins

  • Cytokine profiling - To determine immune polarization:

    • Measure pro-inflammatory (TNF-α, IFN-γ, IL-2, IL-12) and anti-inflammatory (IL-4, IL-10) cytokines

    • Use ELISA or cytometric bead array to quantify cytokine levels

    • Compare responses to whole cell lysate vs. purified YE2117

  • Antibody response characterization:

    • Determine antibody titers using ELISA

    • Assess isotype distribution (IgG1:IgG2a/IgG2b ratios)

    • Evaluate the balance between Th1 and Th2 responses

  • Challenge studies - To assess protective efficacy:

    • Immunize animal models with YE2117 preparations

    • Challenge with virulent Y. enterocolitica

    • Monitor survival rates and bacterial clearance from tissues

    • Quantify bacterial burden in liver and spleen at different timepoints

These methodologies will help determine if YE2117 could be a valuable component of subunit vaccines against Gram-negative facultative intracellular bacterial pathogens.

What computational approaches can predict functional domains and interactions of YE2117?

Several computational approaches can be employed to predict functional domains and interactions of YE2117:

  • Transmembrane topology prediction:

    • TMHMM, TOPCONS, or Phobius algorithms can identify membrane-spanning regions

    • Hydropathy plot analysis to confirm transmembrane segments

    • SignalP for signal peptide prediction

  • Protein family classification:

    • Pfam database searches to identify conserved domains

    • InterPro for functional classification

    • COG/KOG analysis for evolutionary relationships

  • Structural prediction:

    • AlphaFold2 or RoseTTAFold for 3D structure prediction

    • SWISS-MODEL for homology modeling if structural homologs exist

    • I-TASSER for integrative structural prediction

  • Protein-protein interaction prediction:

    • STRING database analysis for potential interaction partners

    • PSICQUIC for experimentally determined interactions of homologs

    • Molecular docking simulations with potential partners

  • Functional site prediction:

    • ConSurf for evolutionary conservation analysis to identify functional sites

    • 3DLigandSite for binding site prediction

    • COACH for ligand-binding site prediction

These computational approaches can guide experimental design by identifying regions of interest for mutagenesis, functional assays, or structural studies of YE2117.

How can CRISPR-Cas9 genome editing be applied to study YE2117 function in Yersinia enterocolitica?

CRISPR-Cas9 technology offers powerful approaches to study YE2117 function:

  • Gene knockout studies:

    • Design sgRNAs targeting the YE2117 gene

    • Introduce frameshift mutations or complete gene deletions

    • Assess phenotypic changes in growth, membrane integrity, and virulence

    • Complement mutations to confirm specificity of observed effects

  • Domain-specific mutations:

    • Create precise point mutations in predicted functional domains

    • Use homology-directed repair with donor templates

    • Evaluate effects on protein localization and function

    • Generate mutation libraries for high-throughput functional screening

  • Protein tagging for localization studies:

    • Insert fluorescent protein tags via CRISPR-mediated homologous recombination

    • Track YE2117 localization during different growth phases and infection conditions

    • Perform live-cell imaging to observe dynamic behaviors

  • Promoter modification:

    • Engineer inducible or repressible YE2117 expression

    • Study effects of protein level modulation

    • Identify conditions that regulate native expression

These approaches can overcome the limited understanding of YE2117 function by creating precisely engineered bacterial strains for detailed phenotypic analysis.

How does the membrane environment affect YE2117 structure and function?

The membrane environment significantly influences membrane protein structure and function:

For YE2117, researchers should consider:

  • Lipid composition effects:

    • Different lipid environments can be tested using reconstitution in proteoliposomes

    • Variations in phospholipid headgroups (PE, PG, CL commonly found in bacterial membranes)

    • Effects of lipid acyl chain length and saturation

    • Potential lipid raft association or exclusion

  • Membrane curvature and thickness:

    • Mismatch between protein hydrophobic thickness and bilayer thickness can affect function

    • Curvature-inducing lipids may influence YE2117 organization

    • Techniques like small-angle X-ray scattering can assess these parameters

  • Protein-lipid interactions:

    • Mass spectrometry can identify tightly bound lipids

    • Molecular dynamics simulations can predict preferential interactions

    • Site-directed mutagenesis of predicted lipid-binding sites can confirm functional importance

  • Oligomerization in membrane context:

    • Native mass spectrometry for oligomeric state determination

    • Single-molecule fluorescence for dynamics in native-like environments

    • FRET studies to assess protein-protein interactions within membranes

Understanding these interactions is crucial as they may affect not only YE2117 structure but also its potential role in bacterial pathogenesis and immune evasion.

What are the most promising future research directions for YE2117?

Several promising research directions for YE2117 include:

  • Structure-function relationship studies:

    • High-resolution structural determination using cryo-EM or X-ray crystallography

    • Correlation of structural features with functional properties

    • Identification of potential binding partners or substrates

  • Role in pathogenesis:

    • Systematic analysis of YE2117 contribution to virulence

    • Host-pathogen interaction studies focused on YE2117

    • Evaluation as a potential therapeutic target

  • Vaccine development:

    • Assessment of YE2117 immunogenicity

    • Development of fusion constructs combining YE2117 with other immunogens

    • Testing protective efficacy in relevant animal models

  • Diagnostic applications:

    • Development of YE2117-based detection methods

    • Evaluation as a biomarker for Y. enterocolitica infection

    • Genotyping applications based on YE2117 sequence variations

  • Comparative analysis across Yersinia species:

    • Evolutionary conservation and divergence studies

    • Functional conservation across pathogenic and non-pathogenic species

    • Identification of species-specific adaptations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.