Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B UPF0442 protein YE0625 (YE0625)

What is the structural composition of YE0625 protein?

YE0625 is a 156-amino acid protein belonging to the UPF0442 protein family in Yersinia enterocolitica serotype O:8 / biotype 1B. According to sequence analysis, the full amino acid sequence is: MVMSLLWALLQDMVLAAIPALGFAMVFNVPMRALRYCALLGALGHGSRMLMIHFGMDIEPASLLASIMIGMIGINWSRWLLAHPKVFTVAAVIPMFPGISAYTAMISVVEISHLGYSEVLMSTMVTNFLKASFIVGSLSIGLSLPGLWLYRKRPGV . The protein contains multiple hydrophobic regions suggestive of membrane association, with predicted transmembrane domains that likely contribute to its functional characteristics within the bacterial membrane.

What expression systems are most effective for producing recombinant YE0625?

E. coli expression systems are the most validated approach for recombinant YE0625 production, with demonstrated success in achieving high protein yields with maintained structural integrity. Based on current protocols, the protein is typically expressed with an N-terminal His-tag to facilitate purification . When designing expression constructs, researchers should consider:

For challenging expression scenarios, Design of Experiments (DoE) approaches can systematically identify optimal conditions by testing multiple variables simultaneously rather than using the inefficient one-factor-at-a-time method .

How should recombinant YE0625 protein be stored to maintain stability?

Proper storage is critical for maintaining YE0625 protein activity. The lyophilized protein should be stored at -20°C to -80°C upon receipt . After reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL, the addition of 5-50% glycerol (with 50% being standard) helps maintain stability during freeze-thaw cycles . For working solutions, store aliquots at 4°C for up to one week, as repeated freeze-thaw cycles significantly reduce protein activity. Experimental data shows that protein stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0 maintains greater than 90% activity when properly aliquoted and stored .

What purification strategy yields the highest purity and activity for YE0625?

A multi-stage purification approach consistently produces YE0625 preparations with greater than 90% purity as determined by SDS-PAGE . The recommended protocol includes:

• Initial capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin to capture the His-tagged protein

• Intermediate purification: Ion exchange chromatography to remove remaining contaminants

• Polishing step: Size exclusion chromatography to separate monomeric protein from aggregates

Critical considerations during purification include:

• Maintaining buffer pH at 8.0 throughout the process to prevent protein destabilization

• Including low concentrations of detergent (0.05-0.1% non-ionic) if membrane association affects solubility

• Verifying protein identity via Western blot or mass spectrometry after purification

How can one implement DoE approaches to optimize YE0625 expression and purification?

Design of Experiments (DoE) offers significant advantages over traditional one-factor-at-a-time optimization by identifying optimal conditions with fewer experiments while capturing factor interactions. For YE0625 optimization, a response surface methodology approach is recommended :

• Factor selection: Identify critical variables affecting expression/purification (temperature, pH, inducer concentration, salt concentration)

• Experimental design: Implement a central composite design or Box-Behnken design

• Execution: Perform experiments according to the design matrix

• Analysis: Use statistical software to analyze results and identify optimal conditions

• Verification: Confirm predicted optimal conditions experimentally

This approach typically reduces optimization time by 60-70% compared to traditional methods while identifying conditions that might be missed in sequential optimization approaches .

What analytical methods are most informative for assessing YE0625 structural integrity?

Multiple complementary techniques should be employed to comprehensively assess YE0625 structural integrity:

When analyzing membrane-associated proteins like YE0625, additional detergent-compatible techniques may be necessary to preserve native structure during analysis.

What approaches can reveal YE0625's role in Yersinia pathogenesis?

Understanding YE0625's role in pathogenesis requires multiple experimental approaches:

• Gene knockout studies: Create YE0625 deletion mutants and assess virulence in cellular and animal models

• Protein localization: Use fluorescently-tagged YE0625 or immunolocalization to determine subcellular distribution

• Interactome analysis: Identify protein binding partners through co-immunoprecipitation followed by mass spectrometry

• Structural studies: Determine the three-dimensional structure through X-ray crystallography or cryo-electron microscopy

• Comparative genomics: Analyze conservation and variation of YE0625 across Yersinia species and strains

The methodologies used for studying virulence factors in other Yersinia species provide valuable templates. For example, studies of Yersinia pseudotuberculosis mutants have demonstrated how specific proteins contribute to pathogenicity and immune response stimulation .

How can YE0625 be employed in immunological studies and vaccine development?

YE0625 may serve as a potential antigen target for vaccine development against Yersinia enterocolitica, following approaches similar to those used with other Yersinia species. Based on immunological techniques established for Yersinia vaccines:

• Antigenicity assessment: Evaluate YE0625's ability to stimulate antibody production using ELISA with recombinant protein

• T-cell response analysis: Measure CD4+ and CD8+ T-cell responses to YE0625 using flow cytometry and cytokine profiling

• Animal model testing: Assess protective efficacy in relevant animal models following immunization with YE0625

Previous research with Yersinia pseudotuberculosis has shown that engineered strains expressing specific antigens can elicit balanced Th1/Th2 immune responses and provide significant protection against challenge . Similar approaches could be applied using YE0625 in Y. enterocolitica vaccine development.

What methods effectively measure protein-protein interactions involving YE0625?

Several complementary techniques provide robust analysis of YE0625 protein interactions:

When analyzing membrane-associated proteins like YE0625, specialized approaches such as membrane yeast two-hybrid systems or chemical cross-linking coupled with mass spectrometry may provide additional insights into the interaction landscape.

How can issues with YE0625 solubility be addressed?

Membrane-associated proteins like YE0625 often present solubility challenges. Implement these strategies to improve solubility:

• Expression optimization: Lower induction temperature (16-18°C) and reduce inducer concentration to slow expression and improve folding

• Buffer optimization: Screen different buffers, pH conditions, and salt concentrations using a factorial design approach

• Solubility enhancers: Add glycerol (5-10%), mild detergents (0.05-0.1% non-ionic), or arginine (50-100 mM) to stabilize the protein

• Fusion partners: Express YE0625 with solubility-enhancing tags such as MBP or SUMO

• Refolding protocols: For inclusion bodies, develop a refolding protocol with gradually decreasing denaturant concentrations

Data from similar membrane proteins suggests that buffer containing 20 mM Tris-HCl pH 8.0, 150 mM NaCl, 5% glycerol, and 0.05% DDM often yields optimal solubility for this class of proteins.

What are effective approaches for resolving protein aggregation during YE0625 purification?

Protein aggregation significantly impacts YE0625 yield and functionality. Address aggregation through these methods:

• Buffer screening: Test buffers with various pH values (7.0-8.5) and ionic strengths (100-500 mM NaCl)

• Additive screening: Evaluate stabilizing additives including glycerol, sucrose, arginine, and proline

• Purification strategy: Incorporate size exclusion chromatography as a final polishing step to separate monomeric protein

• Storage conditions: Store at moderate concentrations (0.5-1.0 mg/mL) with stabilizing agents like trehalose

• Handling practices: Avoid rapid temperature changes and mechanical stress during processing

For YE0625 specifically, adding 6% trehalose to the storage buffer has been demonstrated to significantly reduce aggregation during storage .

How can researchers address challenges in detecting YE0625 expression in vivo?

In vivo detection of YE0625 presents several challenges that can be overcome through these approaches:

• Antibody development: Generate high-affinity antibodies against multiple epitopes of YE0625

• Epitope tagging: Insert small epitope tags (FLAG, V5) at terminals less likely to disrupt function

• Reporter fusions: Create translational fusions with fluorescent proteins or enzymatic reporters

• Sample preparation: Optimize membrane protein extraction protocols with appropriate detergents

• Signal amplification: Employ tyramide signal amplification or proximity ligation assays for low-abundance detection

When working with clinical or environmental samples, PCR-based detection of the YE0625 gene can complement protein detection methods and provide validation of expression.

How can comparative analysis of YE0625 across Yersinia species inform pathogenesis studies?

Comparative analysis of YE0625 homologs provides valuable insights into pathogenesis mechanisms:

• Sequence alignment: Compare YE0625 sequences across pathogenic and non-pathogenic Yersinia species

• Structural modeling: Generate homology models to identify conserved structural features

• Expression profiling: Analyze expression patterns under virulence-inducing conditions

• Functional complementation: Test functional interchangeability through cross-species complementation experiments

• Phylogenetic analysis: Determine evolutionary relationships and selective pressures on YE0625

What role might YE0625 play in developing novel antimicrobial strategies?

YE0625 could serve as a target for novel antimicrobial development through several approaches:

• Structure-based drug design: Using resolved structures to design specific inhibitors

• Functional disruption: Identifying compounds that interfere with YE0625's critical interactions

• Immunotherapeutic approaches: Developing antibodies or immunomodulators targeting YE0625

• CRISPR-based antimicrobials: Designing sequence-specific nucleases targeting the YE0625 gene

• Anti-virulence strategies: Developing compounds that inhibit YE0625 without affecting bacterial viability

Research on other Yersinia virulence factors has demonstrated the potential of targeting specific proteins to attenuate virulence without directly killing bacteria, potentially reducing selective pressure for resistance development.

How can recent advances in structural biology techniques be applied to YE0625 research?

Cutting-edge structural biology techniques offer new opportunities for YE0625 characterization:

These techniques can reveal detailed structural information even for challenging membrane proteins like YE0625, potentially illuminating functional mechanisms and interaction interfaces.