Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Zinc transport protein ZntB (zntB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
zntB; YE2107; Zinc transport protein ZntB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-327
Protein Length
full length protein
Species
Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Target Names
zntB
Target Protein Sequence
MDVVAGKALQVSDAVYSYQLDGKGGVTSISPDAVATAEQPCWLHLDYTHPDSAAWLQNTP LLPEVVRDGLAGESVRPKVTRLGDGTMITLRGINFNNDARPDQLVTIRVYMTDKLIVSTR HRKVYSIDDVLNDLQSGTGPTNSGNWLVEIVDGLTDHTSEFIEDLHDKIIDLEDDLLEQK IPARGQMALLRKQLIVLRRYMAPQRDVFSRLASERLPWMNDDDRRRMQEISERLGRGLED LDSSIARTAVLSDEISSLMADAMNRRTYTMSLLAMVFLPTTFLTGLFGVNLGGIPGNTDS FGFATFCMMLVVLVLGVAWWLKHSKWL
Uniprot No.

Target Background

Function

Mediates the efflux of zinc ions.

Database Links

KEGG: yen:YE2107

STRING: 393305.YE2107

Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural organization of ZntB in Yersinia enterocolitica?

The cytoplasmic domain structures from ZntB homologues have been solved by crystallography. For instance, the Vibrio parahemolyticus ZntB (VpZntB) cytoplasmic domain was resolved at 1.9 Å resolution, revealing the characteristic pentameric organization . Interestingly, despite being crystallized in the presence of 0.2 M MgCl₂, no bound metal ions were observed in the structure. Instead, 25 well-ordered chloride anions (five per monomer) were identified, forming a distinctive chloride ring in the middle of the cytoplasmic pentamer .

The full-length protein contains 327 amino acids in Y. enterocolitica serotype O:8 / biotype 1B, as confirmed by recombinant protein expression studies .

What is the current understanding of ZntB's function in zinc homeostasis?

More recent evidence from cryo-electron microscopy studies of full-length ZntB from Escherichia coli, combined with isothermal titration calorimetry and transport assays using ZntB reconstituted into liposomes, has demonstrated that ZntB mediates Zn²⁺ uptake . This transport is stimulated by a pH gradient across the membrane, utilizing a mechanism that differs from that proposed for homologous CorA channels .

The importance of zinc homeostasis is highlighted by the fact that while zinc is essential for cellular functions, free zinc ions are highly toxic. A typical bacterial cell may contain approximately 100,000 zinc ions, requiring careful regulation through specialized transporters like ZntB to maintain appropriate intracellular concentrations .

How does ZntB differ from other zinc transporters found in bacteria?

ZntB differs from other bacterial zinc transporters in several key aspects:

FeatureZntBOther Bacterial Zinc Transporters (e.g., ZupT, ZitB, ZntA)
Family2-TM-GxNVarious (ZIP family, P-type ATPases, RND)
StructureHomopentamericVaries (monomeric to multi-subunit)
Signature motifGVN instead of GMNVaries by family
Transport directionPrimarily uptake (pH-dependent)Import (ZupT) or export (ZntA, ZitB)
Energy couplingpH gradient-dependentATP-dependent (ZntA) or proton antiport (ZitB)
DistributionPrimarily in proteobacteria (α-, β-, γ-subgroups)Widespread across bacterial taxa

ZntB-type genes are less widely distributed compared to other metal transporters like corA genes. Interestingly, in some bacterial species such as Silicibacter pomeroyi, Idiomarina loihiensis, Vibrio group, and Magnetococcus, ZntB appears to be the only 2-TM-GxN type protein present, with CorA orthologs apparently lacking .

Unlike the ATP-dependent zinc exporters (like ZntA) or the ZIP family importers (like ZupT), ZntB utilizes a pH gradient across the membrane to drive zinc transport .

What experimental approaches are most effective for studying ZntB transport activity?

Several complementary experimental approaches have proven effective for investigating ZntB transport activity:

  • Reconstitution into liposomes: Purified ZntB protein can be reconstituted into liposomes for transport assays using either:

    • Radio-ligand uptake assays: Using ⁶⁵Zn to directly measure transport rates and kinetics

    • Fluorescent transport assays: Employing zinc-sensitive fluorophores like FluoZin-3 to monitor real-time zinc movement

  • Isothermal titration calorimetry (ITC): This technique provides quantitative data on binding affinities, stoichiometry, and thermodynamic parameters of zinc interaction with ZntB

  • Cryo-electron microscopy: For structural analysis of the full-length transporter in different conformational states, providing insights into the transport mechanism

  • Genetic complementation studies: Comparing metal resistance or sensitivity phenotypes between wild-type and ZntB knockout strains under various metal concentrations

  • pH gradient manipulation: Since ZntB activity is stimulated by a pH gradient, experiments controlling internal and external pH can elucidate the coupling mechanism

For functional characterization, researchers should consider multiple approaches to address the historical confusion regarding the directionality of transport (import vs. export). Metal uptake assays in whole cells should be complemented with in vitro reconstitution experiments under controlled conditions to conclusively determine transport direction and mechanism.

What are the optimal conditions for expression and purification of recombinant ZntB?

Based on successful expression and purification protocols for ZntB and related transporters:

Expression system:

  • E. coli is the preferred heterologous expression system for recombinant ZntB from Y. enterocolitica

  • Expression vectors incorporating an N-terminal His-tag facilitate purification via immobilized metal affinity chromatography (IMAC)

  • The full-length protein (327 amino acids) can be successfully expressed in E. coli systems

Purification protocol:

  • Cell lysis in Tris/PBS-based buffer (pH 8.0)

  • IMAC purification using nickel or cobalt resins

  • Size exclusion chromatography for further purification

  • Addition of 6% trehalose in final storage buffer to maintain stability

Storage recommendations:

  • Store at -20°C/-80°C upon receipt

  • Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles

  • For working stocks, store aliquots at 4°C for up to one week

Reconstitution:

  • Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add 5-50% glycerol (final concentration) for long-term storage at -20°C/-80°C

Membrane protein purification presents unique challenges due to the hydrophobic nature of transmembrane domains. When working with full-length ZntB, detergent selection is critical, with n-dodecyl-β-D-maltoside (DDM) often preferred for initial solubilization followed by milder detergents for functional studies.

How does the controversy regarding ZntB's transport direction (importer vs. exporter) impact experimental design?

The controversy surrounding ZntB's transport direction has significant implications for experimental design and interpretation:

  • Directional ambiguity: Initial studies in S. typhimurium suggested that ZntB functions as a zinc and cadmium efflux system , while subsequent research in C. metallidurans indicated an import function . Recent studies with E. coli ZntB using direct transport assays support an uptake mechanism .

  • Species-specific differences: ZntB homologs from different bacterial species may have evolved different functions. For example, Agrobacterium tumefaciens ZntB (AtZntB) shares less than 20% amino acid identity with S. typhimurium ZntB and has a different signature motif (GxxGMNxxDExP instead of GxxGVNxGGxP) .

  • Experimental considerations:

    • Bidirectional capabilities: Researchers should consider testing for transport in both directions

    • pH gradient effects: Since ZntB activity is stimulated by a pH gradient, experimental designs must control and manipulate pH conditions

    • Metal specificity testing: Comprehensive testing with multiple divalent cations (Zn²⁺, Cd²⁺, Co²⁺, Cu²⁺, Fe²⁺, Mg²⁺, Mn²⁺, Ni²⁺, Pb²⁺) is essential to determine specificity

    • Reconstitution systems: In vitro reconstitution into liposomes with controlled internal/external solutions provides the most definitive evidence of transport direction

  • Genetic context: The presence of other zinc transporters in the experimental system may compensate for ZntB mutations, potentially obscuring phenotypes in genetic studies .

Researchers should employ multiple complementary approaches and clearly define the species origin of the ZntB being studied, as functional differences between homologs may exist. Transport assays using purified protein reconstituted into artificial membrane systems currently provide the most reliable evidence for determining the physiological direction of transport.

What structural features distinguish ZntB from its homolog CorA, and how do these relate to functional differences?

Despite belonging to the same 2-TM-GxN family, ZntB and CorA exhibit several structural and functional differences:

FeatureZntBCorA
Signature motifGVNGMN
Ion selectivityPrimarily Zn²⁺Primarily Mg²⁺
Transport mechanismpH gradient-dependentPrimarily driven by Mg²⁺ concentration gradient
Regulatory metal binding sitesLess characterizedWell-characterized divalent cation binding sites
Chloride ion bindingObserved in VpZntB structureNot typically observed
Gating mechanismDistinct from CorABased on divalent cation binding

The crystal structure of VpZntB's cytoplasmic domain revealed specific structural features that may relate to its function:

  • Chloride ion binding: Unlike CorA structures, VpZntB was found to bind 25 chloride ions (five per monomer), forming a distinctive chloride ring in the middle of the cytoplasmic pentamer. This feature may be important for electrostatic tuning of the channel to favor zinc transport .

  • Acidic rings: Two rings of acidic amino acids at the base of the funnel may play a role in stripping water molecules from zinc ions before transport, a critical step in the transport process .

  • Electrostatic properties: The electrostatic characteristics of ZntB are thought to favor passage of zinc ions while excluding monovalent ions like sodium and potassium .

  • Conformational changes: Recent cryo-EM studies of full-length ZntB suggest a transport mechanism that differs from the one proposed for CorA channels, indicating unique structural transitions during the transport cycle .

These structural differences align with the functional divergence between ZntB and CorA, with the former specialized for zinc transport and the latter primarily transporting magnesium. The structural basis for pH-dependent transport in ZntB remains an active area of investigation.

What potential applications exist for ZntB in vaccine development research?

Y. enterocolitica has been investigated as a potential vaccine vector for inducing mucosal immunity against heterologous antigens . While ZntB itself has not been directly implicated in vaccine development, understanding its role in Y. enterocolitica physiology and pathogenesis could contribute to vaccine strategies in several ways:

  • Attenuated strain development: Modifying zinc homeostasis through ZntB mutations could potentially contribute to the development of attenuated Y. enterocolitica strains for vaccine purposes. Proper zinc balance is critical for bacterial survival and virulence .

  • Antigen delivery systems: Y. enterocolitica possesses a Type III secretion system capable of delivering bacterial effector proteins (Yops) into eukaryotic cells. This system has been exploited for vaccine vector development . Understanding how zinc transport via ZntB interacts with these virulence mechanisms could inform better vaccine design.

  • Adjuvant development: Zinc plays important roles in immune function. Controlled modulation of zinc availability through engineered ZntB variants might potentially be explored for adjuvant effects.

  • Target for immune protection: Research has established that both humoral and cell-mediated immune responses are required for comprehensive protection against Yersinia infection . Bivalent fusion proteins comprising immunologically active regions of Y. pestis LcrV and YopE proteins have shown promise in providing protection against lethal Y. enterocolitica challenge .

Design strategies for Y. enterocolitica-based vaccine vectors have included:

  • Use of attenuated strains lacking effector Yops (YopH, YopO, YopP, YopE, YopM, and YopT)

  • Construction of expression vectors containing strong yopE promoters and the first 16 codons of yopE for fusion with heterologous antigens

  • Exploitation of the type III secretion system for delivery of antigens directly into host cells

While not directly involved in these approaches, ZntB and zinc homeostasis represent an important aspect of bacterial physiology that could be manipulated in future vaccine development strategies.

How might antimicrobial resistance impact research on ZntB and other transport proteins in Y. enterocolitica?

The emergence of antimicrobial resistance in Y. enterocolitica presents significant challenges and opportunities for research on transport proteins like ZntB:

  • Co-selection of resistance traits: Recent studies have identified multidrug-resistant Y. enterocolitica strains carrying the Tn2670 transposon containing resistance genes (catA1, aadA1, and sul1) as well as metal resistance determinants . This co-occurrence of antibiotic and metal resistance has important implications for ZntB research, as selective pressures from antibiotics might indirectly affect metal homeostasis systems.

  • Metal transport and antibiotic efficacy: Zinc and other metals play crucial roles in bacterial physiology, potentially affecting antibiotic susceptibility. The interplay between ZntB function and antimicrobial resistance mechanisms remains largely unexplored but may be significant.

  • Horizontal gene transfer: The presence of mobile genetic elements in Y. enterocolitica, such as the Tn2670 transposon and small resistance plasmids , raises questions about the potential transfer of genes involved in metal homeostasis, including potentially modified versions of zntB.

  • Research considerations:

    • Studies of ZntB function should account for potential interactions with antimicrobial resistance mechanisms

    • Strain selection for ZntB characterization should consider the antimicrobial resistance profile

    • Investigations into potential co-regulation of metal transport and antimicrobial resistance genes may yield important insights

  • Novel therapeutic approaches: Understanding ZntB function in the context of antimicrobial resistance could lead to new strategies for combating resistant Y. enterocolitica, potentially through disruption of metal homeostasis to enhance antibiotic efficacy.

The horizontal gene transfer events observed in Y. enterocolitica suggest that this bacterium may serve as a carrier for multiple resistance determinants in food-related environments, highlighting the importance of comprehensive studies that connect transport protein function to broader aspects of bacterial adaptation and survival.

What methodological approaches could resolve the conflicting data on ZntB's role in different bacterial species?

The conflicting reports regarding ZntB's role across different bacterial species necessitate comprehensive methodological approaches to resolve these discrepancies:

  • Standardized expression and functional analysis:

    • Comparative analysis of ZntB homologs from multiple species (S. typhimurium, C. metallidurans, A. tumefaciens, E. coli, Y. enterocolitica) expressed under identical conditions

    • Use of isogenic expression systems to eliminate host-specific factors

    • Consistent purification and reconstitution protocols to enable direct functional comparisons

  • Comprehensive transport assays:

    • Bidirectional transport measurements using complementary techniques

    • Radio-ligand uptake assays with ⁶⁵Zn under varied pH and concentration gradients

    • Fluorescence-based assays to monitor real-time transport dynamics

    • Patch-clamp electrophysiology for direct measurement of ion channel activity

  • Advanced structural biology approaches:

    • Comparative cryo-EM analysis of multiple ZntB homologs in different conformational states

    • Hydrogen-deuterium exchange mass spectrometry to identify dynamic regions during transport

    • Molecular dynamics simulations to model ion permeation pathways

  • Sequence-structure-function relationship analysis:

    • Targeted mutagenesis of signature motifs (converting GVN to GMN and vice versa)

    • Creation of chimeric transporters combining domains from different homologs

    • Evolutionary analysis to identify species-specific adaptations in ZntB function

  • Physiological context assessment:

    • Comprehensive phenotypic characterization of zntB deletion mutants across multiple species

    • Metal supplementation and depletion studies in various growth conditions

    • Analysis of gene expression patterns in response to zinc availability

  • In vivo metal tracking:

    • Use of zinc-specific fluorescent probes to track intracellular zinc pools

    • Synchrotron X-ray fluorescence microscopy for spatial mapping of metals

    • Radioactive tracer studies to measure flux rates in whole cells

By implementing these methodological approaches systematically across multiple ZntB homologs, researchers could reconcile the conflicting data and develop a more nuanced understanding of how ZntB function may have diverged across bacterial species.

How does the genomic context of zntB in Y. enterocolitica influence its expression and function?

The genomic context of zntB in Y. enterocolitica provides important insights into its regulation, expression, and functional significance:

  • Genomic architecture of Y. enterocolitica: The genome of Y. enterocolitica strain 8081 (serotype 0:8; biotype 1B) is characterized as a "patchwork of horizontally acquired genetic loci," including a plasticity zone of 199 kb with a high density of virulence genes . This mosaic genomic structure suggests that genes like zntB may be influenced by their genomic neighborhood.

  • Regulatory elements: The expression of zntB may be controlled by:

    • Metal-responsive transcription factors similar to other zinc homeostasis genes

    • Horizontally acquired regulatory elements specific to Y. enterocolitica

    • Integration into existing regulatory networks governing stress responses

  • Metabolic context: Y. enterocolitica possesses unique metabolic operons absent in related enteropathogens like Y. pseudotuberculosis, indicating "major differences in niche and nutrients used within the mammalian gut" . These include clusters directing:

    • Production of hydrogenases

    • Tetrathionate respiration

    • Cobalamin synthesis

    • Propanediol utilization

    The zntB gene likely functions within this specialized metabolic network, potentially responding to niche-specific zinc availability.

  • Evolutionary considerations: Comparative genomic analyses have identified "ancestral clusters of genes potentially important in enteric survival and pathogenesis" in Y. enterocolitica that have been lost in other Yersinia lineages . This evolutionary pattern may extend to metal transport systems like ZntB, suggesting adaptation to specific environmental niches.

  • Pathogenicity associations: The "extraordinarily high density of virulence genes" in the plasticity zone of Y. enterocolitica raises questions about potential connections between ZntB function and virulence. Zinc availability is known to influence bacterial pathogenicity, making the genomic context of zntB particularly relevant for understanding Y. enterocolitica's interaction with hosts.

Understanding the genomic context of zntB is essential for interpreting its functional role in Y. enterocolitica and may provide insights into how horizontal gene transfer has shaped zinc homeostasis in this important pathogen.

What techniques can be used to study the interaction between ZntB and other components of zinc homeostasis in Y. enterocolitica?

Investigating the interactions between ZntB and other components of zinc homeostasis requires a multi-faceted approach:

  • Transcriptomic analysis:

    • RNA-Seq under varying zinc concentrations to identify co-regulated genes

    • ChIP-Seq to identify transcription factors binding to the zntB promoter

    • Single-cell RNA-Seq to assess population heterogeneity in zinc response

  • Proteomic approaches:

    • Co-immunoprecipitation to identify direct protein-protein interactions

    • Crosslinking mass spectrometry to map interaction interfaces

    • Proximity labeling techniques (BioID, APEX) to identify proteins in the vicinity of ZntB in vivo

    • Blue native PAGE to identify stable membrane protein complexes involving ZntB

  • Genetic interaction mapping:

    • Synthetic genetic array analysis to identify genes with functional relationships to zntB

    • CRISPR interference screens to identify genetic dependencies in zinc-limited conditions

    • Suppressor mutant screening to identify compensatory pathways when ZntB is non-functional

  • Live-cell imaging techniques:

    • Fluorescent protein fusions to track ZntB localization and dynamics

    • Förster resonance energy transfer (FRET) to detect protein-protein interactions in live cells

    • Zinc-specific fluorescent sensors to correlate ZntB activity with local zinc concentrations

  • Systems biology approaches:

    • Mathematical modeling of zinc homeostasis incorporating ZntB transport kinetics

    • Network analysis to position ZntB within the broader zinc regulatory network

    • Integration of transcriptomic, proteomic, and metabolomic data to build comprehensive models

  • Phenotypic profiling:

    • Growth assays under zinc limitation with combinations of mutations in zinc homeostasis genes

    • Virulence assays to assess the contribution of ZntB to pathogenicity in the context of other zinc transporters

    • Zinc accumulation measurements in strains with various combinations of zinc transporter mutations

These complementary approaches would provide a comprehensive understanding of how ZntB functions within the broader context of zinc homeostasis in Y. enterocolitica, potentially revealing unexpected interactions and regulatory relationships that influence bacterial physiology and pathogenicity.

What are the critical quality control parameters for assessing purified recombinant ZntB protein?

When working with purified recombinant ZntB, several quality control parameters are essential for ensuring reliable experimental results:

  • Purity assessment:

    • SDS-PAGE analysis with Coomassie or silver staining (target: >90% purity)

    • Size exclusion chromatography to verify monodispersity

    • Mass spectrometry to confirm protein identity and detect potential contaminants

  • Structural integrity:

    • Circular dichroism spectroscopy to verify secondary structure content

    • Thermal shift assays to assess protein stability

    • Dynamic light scattering to evaluate aggregation state

    • Negative-stain electron microscopy to confirm pentameric assembly

  • Functional verification:

    • Metal binding assays using isothermal titration calorimetry or fluorescence spectroscopy

    • ATPase activity assays (if applicable)

    • Transport activity in reconstituted liposomes

  • Critical specifications for Y. enterocolitica ZntB:

    • Molecular weight verification: Full-length protein (327 amino acids) with His-tag

    • Oligomeric state: Pentameric assembly

    • Buffer compatibility: Tris/PBS-based buffer, pH 8.0, with 6% trehalose

    • Stability indicators: Resistance to multiple freeze-thaw cycles

    • Reconstitution efficiency: Successful incorporation into liposomes with correct orientation

  • Storage condition optimization:

    • Addition of 5-50% glycerol for long-term storage at -20°C/-80°C

    • Aliquoting to avoid repeated freeze-thaw cycles

    • Short-term storage at 4°C limited to one week

  • Batch-to-batch consistency:

    • Reproducible specific activity in functional assays

    • Consistent yield from expression system

    • Comparable purity profiles across production batches

Proper quality control of recombinant ZntB is particularly important given its complex pentameric structure and membrane protein nature. Variations in purification or storage conditions can significantly impact experimental outcomes, especially in functional studies where proper folding and assembly are critical for activity.

How can researchers optimize expression systems for producing functional ZntB for structural and functional studies?

Optimizing expression systems for ZntB requires careful consideration of multiple factors to ensure high yields of functional protein:

  • Expression host selection:

    • E. coli is the preferred system for recombinant ZntB expression

    • Consider specialized strains for membrane proteins:

      • C41(DE3) or C43(DE3) derived from BL21(DE3) with adaptations for membrane protein expression

      • Lemo21(DE3) for tunable expression level control

      • SHuffle strains for proteins requiring disulfide bonds

  • Vector design optimization:

    • Promoter selection: T7 promoter with tunable induction for tight control

    • Fusion tags: N-terminal His-tag for purification

    • Codon optimization: Adjust for E. coli codon bias while maintaining critical folding elements

    • Signal sequences: Consider inclusion of signal sequences for proper membrane targeting

  • Expression condition optimization:

    • Temperature: Lower temperatures (16-20°C) often improve membrane protein folding

    • Induction strategy: Gradual induction with lower IPTG concentrations (0.1-0.5 mM)

    • Media formulation: Enriched media (TB, 2xYT) or defined media with supplements

    • Additives: Consider glycerol (5-10%) or specific lipids to stabilize membrane proteins

    • Induction timing: Induce at mid-log phase (OD600 ~0.6-0.8) for optimal balance of cell density and protein synthesis capacity

  • Solubilization and purification strategy:

    • Detergent screening: Test multiple detergents for optimal extraction efficiency

    • Recommended detergents: n-Dodecyl-β-D-maltoside (DDM), n-Decyl-β-D-maltoside (DM), or Lauryl maltose neopentyl glycol (LMNG)

    • Purification protocol: IMAC followed by size exclusion chromatography

    • Buffer optimization: Include stabilizing agents such as trehalose (6%)

  • Functional validation methods:

    • Reconstitution efficiency testing in proteoliposomes

    • Transport activity assays using fluorescent zinc indicators or radioactive zinc

    • Thermal stability assessment in various buffer conditions

  • Scale-up considerations:

    • Bioreactor parameters for maintaining optimal dissolved oxygen and pH

    • Fed-batch strategies to achieve higher cell densities

    • Harvest timing optimization to maximize yield of correctly folded protein

By systematically optimizing these parameters, researchers can significantly improve the yield and quality of recombinant ZntB for structural and functional studies, particularly important for challenging membrane proteins that require their native pentameric assembly for proper function.

How could computational modeling advance our understanding of ZntB transport mechanisms?

Computational modeling offers powerful approaches to investigate ZntB transport mechanisms that are challenging to study experimentally:

  • Molecular dynamics (MD) simulations:

    • All-atom MD simulations to model conformational changes during transport cycle

    • Coarse-grained simulations to extend timescales for observing complete transport events

    • Free energy calculations to determine energy barriers for zinc permeation

    • Identification of water molecules and their role in zinc dehydration during transport

  • Quantum mechanics/molecular mechanics (QM/MM) approaches:

    • Detailed modeling of zinc coordination chemistry at binding sites

    • Investigation of proton-coupled transport mechanisms

    • Understanding the energetics of metal ion selectivity

  • Homology modeling and structure prediction:

    • Generation of full-length ZntB models using AlphaFold2 or RoseTTAFold

    • Comparative modeling across different bacterial species to identify structural determinants of functional differences

    • Prediction of conformational states not captured in experimental structures

  • Electrostatic calculations:

    • Poisson-Boltzmann calculations to map the electrostatic potential within the transport pathway

    • Understanding the role of the chloride ring observed in crystal structures

    • Modeling how pH gradients might affect charge distribution and transport

  • Network analysis and machine learning approaches:

    • Identification of allosteric communication pathways within the pentameric assembly

    • Prediction of critical residues for transport function

    • Classification of ZntB variants based on predicted functional properties

  • Systems biology modeling:

    • Integration of ZntB transport kinetics into whole-cell models of zinc homeostasis

    • Prediction of phenotypic outcomes from perturbations to zinc transport systems

    • Understanding emergent properties of zinc regulation networks

Computational modeling could specifically address key questions about ZntB, including:

  • How does the pentameric assembly coordinate zinc transport?

  • What is the molecular basis for pH-dependent transport?

  • How do structural differences between ZntB and CorA translate to functional specialization?

  • What conformational changes occur during the transport cycle?

These approaches would complement experimental studies and provide molecular-level insights into ZntB function that are difficult to obtain through experimental methods alone.

What potential exists for targeting ZntB in antimicrobial development against Y. enterocolitica?

The essential role of zinc in bacterial physiology makes ZntB a potential target for novel antimicrobial strategies against Y. enterocolitica:

  • Rationale for targeting ZntB:

    • Zinc is critical for multiple cellular processes in bacteria

    • Disruption of zinc homeostasis could potentiate existing antibiotics

    • Host immune systems already target zinc availability as an antimicrobial strategy

    • ZntB's structural differences from human zinc transporters offer selectivity potential

  • Potential targeting strategies:

    • Direct inhibitors: Small molecules that block the transport pathway

    • Allosteric modulators: Compounds that disrupt conformational changes required for transport

    • Interface disruptors: Molecules that interfere with pentamer assembly

    • Zinc mimetics: Non-transportable zinc analogs that compete for binding

    • pH gradient disruptors: Compounds that neutralize the pH gradient driving ZntB function

  • Advantages as a drug target:

    • Membrane location makes it accessible to drugs without requiring cellular entry

    • Unique pentameric structure provides multiple binding sites for potential cooperativity

    • No direct human homolog minimizes potential toxicity

    • Potential for species-specific targeting based on sequence variations

  • Challenges and considerations:

    • Redundancy in zinc transport systems may limit efficacy as a single target

    • Potential for rapid resistance development

    • Membrane protein targets often present challenges for drug delivery

    • Limited understanding of structure-function relationships

  • Combination approaches:

    • ZntB inhibitors paired with conventional antibiotics

    • Simultaneous targeting of multiple zinc transport systems

    • Combining with compounds that sequester zinc

    • Integration with host immune strategies that limit zinc availability

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.