Recombinant Yersinia pestis Arginine exporter protein ArgO (argO)

Shipped with Ice Packs
In Stock

Description

Functional Homology and Potential Roles

While no direct functional studies on Y. pestis argO are available, homology to E. coli’s argO suggests analogous roles:

  • Arginine Export: E. coli argO mediates arginine efflux, regulated by the transcription factor ArgP . Overexpression in E. coli increases arginine secretion, while null mutations confer sensitivity to the arginine analog canavanine .

  • Regulatory Mechanisms: In E. coli, argO expression is induced by arginine and suppressed by lysine via ArgP . Similar regulation may exist in Y. pestis.

  • Pathogenic Relevance: Arginine exporters in pathogens often balance intracellular amino acid concentrations or export antimetabolites like canavanine .

Applications in Research and Diagnostics

Recombinant ArgO is used in:

ApplicationDescriptionSource
Antigen ProductionPurified protein for vaccine development or serological assays
ELISA KitsDetection of anti-ArgO antibodies in immune responses
Structural StudiesCrystallization or NMR studies to map binding sites or transporter dynamics

Comparative Analysis with Homologs

FeatureY. pestis ArgO (argO)E. coli argO (yggA)
RegulatorNot explicitly identifiedArgP (LysR-type transcriptional activator)
Substrate SpecificityArginine (inferred)Arginine, canavanine
Clinical RelevancePotential vaccine antigen or diagnostic markerModel for antimetabolite resistance mechanisms

Note: Direct experimental validation of substrate specificity in Y. pestis is pending.

Knowledge Gaps and Future Directions

  1. Functional Validation: No studies confirm argO’s role in arginine efflux or pathogenicity in Y. pestis.

  2. Regulatory Networks: Identification of transcriptional regulators analogous to E. coli’s ArgP is needed.

  3. Structural Dynamics: High-resolution structures could elucidate transport mechanisms.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing it.
Synonyms
argO; YPDSF_0595; Arginine exporter protein ArgO
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-205
Protein Length
full length protein
Species
Yersinia pestis (strain Pestoides F)
Target Names
argO
Target Protein Sequence
MLAVYLHGFILSAAMILPLGPQNVFVMNQGIKRQHHLMSASLCALSDIILICAGIFGGSA LLSRSPLLLALVTWGGVAFLMWYGWGALMAAWRGDGVASSATSVTQGRWRILVTLLAVTW LNPHVYLDTFVVLGSLGGQLLPDIRPWFALGAVTASIVWFFALALLAAWLSPWLNRPVAQ RIINLFVGGVMGFIAFQLARQGFGL
Uniprot No.

Target Background

Function
ArgO, the Arginine exporter protein, plays a crucial role in the export of arginine. It is essential for regulating intracellular arginine levels and maintaining the appropriate balance between arginine and lysine.
Database Links
Protein Families
LysE/ArgO transporter (TC 2.A.75) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Arginine exporter protein ArgO in Yersinia pestis and what is its basic function?

ArgO, also known as YpAngola_A3819, is a membrane protein in Yersinia pestis that functions as an arginine exporter. It is a 205-amino acid protein that mediates the transport of arginine across bacterial membranes . This transport function is critical for maintaining amino acid homeostasis in Y. pestis, potentially influencing bacterial metabolism, stress response, and pathogenicity. Unlike virulence-associated proteins such as F1 and V antigens, ArgO primarily serves metabolic functions related to amino acid transport.

What expression systems are used for producing recombinant ArgO?

Escherichia coli is the primary expression system utilized for recombinant ArgO production . While plant-based expression systems using Nicotiana benthamiana with a deconstructed tobacco mosaic virus vector have been employed for other Y. pestis antigens like F1 and V proteins , E. coli remains the preferred system for ArgO due to:

Expression SystemAdvantagesLimitations
E. coliHigh yield, rapid growth, cost-effective, established protocolsPotential protein folding issues for membrane proteins
Plant-based (N. benthamiana)Scalable, proper eukaryotic folding, low endotoxinLonger production time, potentially lower yields for bacterial proteins

How might ArgO contribute to Y. pestis pathogenicity and virulence?

While the direct role of ArgO in Y. pestis virulence has not been fully characterized, arginine metabolism plays important roles in bacterial pathogenesis. ArgO may contribute to virulence through:

  • Regulation of intracellular arginine pools during infection

  • Contribution to acid resistance mechanisms in phagolysosomal environments

  • Potential modulation of host arginine-dependent immune responses

Unlike the well-characterized F1 and V antigens that are major virulence factors and vaccine targets for Y. pestis , the contribution of metabolic transporters like ArgO to pathogenesis remains an area requiring further research.

What are the optimal experimental approaches for studying membrane-associated transport proteins like ArgO?

For comprehensive characterization of ArgO function and structure, researchers should consider:

TechniqueApplicationAdvantages
Liposome reconstitutionTransport activity measurementDirect quantification of transport function
Site-directed mutagenesisIdentification of functional residuesPinpoints critical amino acids for catalysis or substrate binding
Isothermal titration calorimetryBinding affinity measurementDetermines thermodynamic parameters of substrate binding
Cysteine accessibility methodsTopology mappingReveals membrane-embedded vs. accessible regions
Molecular dynamics simulationsStructural dynamicsProvides insights into conformational changes during transport

These approaches provide complementary data that together create a comprehensive understanding of transport mechanism, substrate specificity, and structural dynamics.

What are the challenges in expressing and purifying functional ArgO protein?

As a membrane protein, ArgO presents several technical challenges:

  • Toxicity to expression hosts when overexpressed

  • Requirements for proper membrane insertion during expression

  • Need for detergents that maintain native protein conformation during extraction

  • Potential loss of function during purification and reconstitution

The commercial preparation of recombinant ArgO addresses these challenges through specific buffer formulations (Tris/PBS-based buffer with 6% Trehalose, pH 8.0) and storage recommendations to maintain stability . Researchers should avoid repeated freeze-thaw cycles and consider adding glycerol (final concentration 5-50%) for long-term storage at -20°C/-80°C .

How can site-directed mutagenesis enhance our understanding of ArgO's function?

Site-directed mutagenesis provides valuable insights into structure-function relationships of ArgO by:

  • Identifying critical residues involved in arginine binding and transport

  • Determining the role of conserved motifs in transport mechanism

  • Mapping the transport pathway through the protein

  • Understanding conformational changes during the transport cycle

A systematic approach might include:

  • Alanine scanning of charged residues within predicted transmembrane domains

  • Conservative substitutions of potential substrate-binding residues

  • Mutation of conserved motifs identified through alignment with other arginine transporters

  • Introduction of cysteine residues for crosslinking studies

How does ArgO compare to F1 and V antigens as potential research targets in Y. pestis studies?

FeatureArgOF1 and V Antigens
Primary functionMetabolic (arginine transport)Virulence and host immune evasion
Vaccine potentialLimitedHigh (fusion F1-V proteins protect against pneumonic and bubonic plague)
LocationMembrane-embeddedSurface-exposed (F1) or secreted (V)
ConservationMay vary between Y. pestis strainsHighly conserved; F1-negative strains exist but are rare
Detection applicationsPotential species markerEstablished targets for diagnostic antibodies

F1 and V antigens have received significantly more research attention due to their direct role in virulence and potential as vaccine candidates, while metabolic proteins like ArgO represent understudied aspects of Y. pestis biology.

What protocols are recommended for reconstituting lyophilized ArgO protein?

The optimal reconstitution protocol for lyophilized ArgO protein is:

  • Briefly centrifuge the vial before opening to bring contents to the bottom

  • Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (with 50% being the standard recommendation)

  • Aliquot for long-term storage at -20°C/-80°C to avoid repeated freeze-thaw cycles

This protocol helps maintain protein stability and functionality while minimizing degradation.

How can researchers validate the functional activity of recombinant ArgO?

Functional validation of recombinant ArgO should employ multiple complementary approaches:

  • Transport assays:

    • Reconstitution into proteoliposomes followed by measurement of arginine transport

    • Fluorescence-based assays using arginine analogs to monitor transport kinetics

  • Binding studies:

    • Isothermal titration calorimetry to determine binding affinity and thermodynamics

    • Fluorescence anisotropy with labeled arginine to measure binding constants

  • Complementation studies:

    • Expression in ArgO-deficient bacterial strains to restore arginine export function

    • Growth assays under conditions where arginine export is essential

What analytical techniques best characterize ArgO's membrane topology?

To determine how ArgO is arranged in the membrane, researchers should consider:

  • Computational prediction:

    • Hydrophobicity analysis and transmembrane domain prediction

    • Homology modeling based on related transporters with known structures

  • Experimental validation:

    • Cysteine accessibility methods to identify exposed residues

    • Protease protection assays to determine cytoplasmic vs. periplasmic domains

    • GFP fusion analysis at different positions to map membrane orientation

  • Structural techniques:

    • Circular dichroism spectroscopy to estimate secondary structure content

    • Site-directed spin labeling combined with EPR spectroscopy for distance measurements

What antibody-based detection methods could be developed for ArgO protein?

Similar to the approach used for developing antibodies against F1 antigen , researchers could develop:

  • Recombinant antibody fragments:

    • Single-chain variable fragments (scFvs) through phage display selection

    • These can be expressed as phage-displayed scFvs for enhanced stability

  • Detection formats:

    • Flow cytometry using fluorescently labeled antibodies

    • ELISA-based detection systems with relevant controls to ensure specificity

    • Whole-cell detection methods similar to those developed for F1 antigen

When developing these assays, researchers should be aware of potential cross-reactivity with other Yersinia species, as was observed with some F1-specific antibodies showing slight cross-reactivity with F1-negative Yersinia strains .

What are the optimal buffer conditions for maintaining ArgO stability?

Based on commercial preparations, the following buffer conditions are recommended:

ComponentRecommended ConditionPurpose
Buffer systemTris/PBS-basedMaintains physiological pH and ionic strength
pH8.0Optimal for stability
Stabilizers6% TrehalosePrevents denaturation during lyophilization and storage
Long-term storage5-50% glycerol at -20°C/-80°CCryoprotection

Researchers should avoid repeated freeze-thaw cycles to maintain protein integrity and function . For membrane proteins like ArgO, addition of mild detergents may be necessary to maintain solubility while preserving native conformation during certain experimental procedures.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.