Recombinant Yersinia pestis bv. Antiqua Arginine exporter protein ArgO (argO)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

The Recombinant ArgO protein is a full-length, His-tagged variant of the native arginine exporter from Yersinia pestis bv. Antiqua, a biovar associated with plague pathogenesis . It facilitates arginine efflux to maintain intracellular amino acid balance and mitigate toxicity . Two strain-specific isoforms exist:

  • Angola strain: UniProt ID A9R4J5

  • Nepal516 strain: UniProt ID Q1CEY6

Primary Sequence

The protein comprises 205 amino acids with the sequence:
MLAVYLHGFILSAAMILPLGPQNVFVMNQGIKRQHHLMSASLCALSDIILICAGIFGGSA LLSRSPLLLALVTWGGVAFLMWYGWGALMAAWRGDGVASSATSVTQGRWRILVTLLAVTW LNPHVYLDTFVVLGSLGGQLLPDIRPWFALGAVTASIVWFFALALLAAWLSPWLNRPVAQ RIINLFVGGVMGFIAFQLARQGFGL .

Physical Properties

PropertySpecification
Molecular Weight~23 kDa (calculated)
TagN-terminal His tag
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based, 6% Trehalose, pH 8.0
Reconstitution0.1–1.0 mg/mL in sterile water + glycerol

Arginine Export Mechanism

ArgO mediates arginine efflux under regulation by ArgP, a LysR-type transcriptional activator . Key functional insights include:

  • Induction by arginine: argO expression increases in response to extracellular arginine .

  • Lysine suppression: Lysine competitively inhibits ArgO activity, reducing arginine export .

  • Toxin resistance: Deletion of argO or argP enhances sensitivity to canavanine, an arginine analog .

Pathogen Adaptation

Comparative genomics of Y. pestis strains reveals gene reduction patterns, but argO remains conserved in Antiqua biovars, suggesting its role in host-environment adaptation .

Experimental Use

  • ELISA development: Commercial kits utilize Recombinant ArgO for antibody detection (e.g., CSB-CF432357YAM, CSB-CF625454YAG) .

  • Efflux assays: Used to quantify arginine transport kinetics in E. coli overexpression systems .

Strain-Specific Studies

StrainUnique FeaturesReference
AngolaCloser phylogenetically to Y. pseudotuberculosis
Nepal516Exhibits distinct genomic deletions

Production and Quality Control

  • Expression system: E. coli .

  • Storage: Lyophilized powder stable at -20°C/-80°C; avoid freeze-thaw cycles .

  • Validation: Confirmed via mass spectrometry and N-terminal sequencing .

Future Directions

Current research focuses on:

  • Structural modeling: To map arginine-binding domains.

  • Pathogenicity studies: Role in Y. pestis survival during host infection.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please include it in your order notes, and we will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery estimates, please consult your local distributors.
Note: Our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
argO; YpAngola_A3819; Arginine exporter protein ArgO
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-205
Protein Length
full length protein
Species
Yersinia pestis bv. Antiqua (strain Angola)
Target Names
argO
Target Protein Sequence
MLAVYLHGFILSAAMILPLGPQNVFVMNQGIKRQHHLMSASLCALSDIILICAGIFGGSA LLSRSPLLLALVTWGGVAFLMWYGWGALMAAWRGDGVASSATSVTQGRWRILVTLLAVTW LNPHVYLDTFVVLGSLGGQLLPDIRPWFALGAVTASIVWFFALALLAAWLSPWLNRPVAQ RIINLFVGGVMGFIAFQLARQGFGL
Uniprot No.

Target Background

Function
ArgO, the Arginine exporter protein from *Yersinia pestis* bv. Antiqua, plays a crucial role in the export of arginine. It is essential for maintaining intracellular arginine levels and ensuring the appropriate balance between arginine and lysine.
Database Links
Protein Families
LysE/ArgO transporter (TC 2.A.75) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional significance of ArgO in Yersinia pestis bv. Antiqua?

ArgO (previously annotated as yggA) functions as an arginine exporter protein in Y. pestis bv. Antiqua. This membrane protein facilitates the efflux of arginine from bacterial cells, playing a critical role in amino acid homeostasis. Based on functional studies in E. coli, ArgO's physiological role appears to be twofold: preventing the accumulation of potentially toxic levels of arginine or its analogs (such as canavanine), and maintaining appropriate balance between intracellular lysine and arginine concentrations . The protein belongs to a class of relatively small transport proteins that mediate amino acid export across bacterial membranes. Its importance in bacterial physiology makes it a target of interest for both basic research and potential therapeutic interventions.

How is the expression of ArgO regulated in bacterial systems?

The expression of ArgO is under the transcriptional control of ArgP (previously called iciA), which encodes a LysR-type transcriptional regulator protein. The regulatory mechanism involves:

  • ArgP functions as a transcriptional activator of the argO gene

  • This activation is enhanced by arginine and inhibited by lysine

  • Dipeptides containing arginine (e.g., arginylalanine) or lysine (e.g., lysylalanine) can mimic the effects of free amino acids

  • Null mutations in either argO or argP result in supersensitivity to the arginine analog canavanine

  • Dominant missense mutations in argP can lead to constitutive expression of argO

This regulatory system ensures that ArgO is expressed when needed for arginine export, allowing bacterial cells to maintain optimal intracellular amino acid levels.

What are the optimal conditions for expressing recombinant Y. pestis ArgO protein in E. coli systems?

For optimal expression of recombinant Y. pestis bv. Antiqua ArgO protein in E. coli systems, researchers should consider the following methodological approach:

  • Expression System Selection: Use E. coli strains optimized for recombinant protein expression (e.g., BL21(DE3) for T7 promoter-based expression)

  • Vector Design: Incorporate an N-terminal His-tag for purification purposes, as demonstrated in commercial preparations

  • Induction Parameters:

    • Temperature: Lower temperatures (16-25°C) may improve proper folding

    • Inducer concentration: Optimize IPTG concentration (typically 0.1-1.0 mM)

    • Induction time: 4-16 hours depending on expression temperature

  • Extraction Protocol:

    • For membrane proteins like ArgO, use appropriate detergents for solubilization

    • Consider mild detergents that maintain protein conformation and function

The target protein length should be 205 amino acids for the full-length ArgO protein . Optimization of these parameters may be necessary based on specific research objectives and experimental setup.

What purification strategies are most effective for isolating functional recombinant ArgO protein?

Purification of recombinant ArgO protein requires a strategic approach to maintain protein functionality while achieving high purity. The following methodological workflow is recommended:

  • Initial Capture:

    • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resins for His-tagged ArgO protein

    • Optimize imidazole concentration in binding and washing buffers to minimize non-specific binding

  • Secondary Purification:

    • Size exclusion chromatography to remove aggregates and further increase purity

    • Ion exchange chromatography may be useful as an intermediate step

  • Buffer Optimization:

    • Include appropriate detergents throughout purification to maintain membrane protein stability

    • Consider including glycerol (5-10%) to enhance protein stability

    • Final buffer composition similar to commercial preparations: Tris/PBS-based buffer with 6% Trehalose at pH 8.0

  • Quality Control Assessments:

    • SDS-PAGE analysis to confirm purity (target >90%)

    • Western blot using anti-His antibodies to verify identity

    • Functional assays to confirm arginine export activity

This approach typically yields protein preparations of greater than 90% purity as determined by SDS-PAGE, suitable for subsequent structural and functional studies .

How can recombinant ArgO protein be utilized in vaccine development strategies against Y. pestis?

Utilizing recombinant ArgO in vaccine development requires a multifaceted approach that leverages emerging knowledge in structural vaccinology and immunology. The methodological framework includes:

  • Epitope Mapping and Selection:

    • Perform computational epitope prediction to identify ArgO regions with high antigenic potential

    • Validate predicted epitopes using experimental approaches such as peptide arrays

    • Select epitopes that trigger both B-cell and T-cell responses

  • Multi-Epitope Vaccine Construction:

    • Similar to approaches used for other Y. pestis antigens, incorporate ArgO epitopes into multi-epitope vaccine constructs

    • Utilize appropriate linkers (EAAK, AAY, GPGPG) to connect CTL, HTL, and B-cell epitopes

    • Add adjuvants such as beta-defensin at the N-terminal to enhance immunogenicity

  • Recombinant Expression Platform Selection:

    • Consider developing attenuated Y. pseudotuberculosis strains as vaccine vectors

    • Construct expression systems that can simultaneously deliver ArgO along with established protective antigens like LcrV and F1

  • Evaluation Framework:

    • Assess physiochemical properties including stability, antigenicity, and allergenicity

    • Perform molecular dynamics simulations to predict vaccine-immune receptor interactions

    • Conduct immune simulation studies to predict response patterns

This approach aligns with recent advances in Y. pestis vaccine development, where proteome-wide target annotation has identified several essential vaccine targets (rstB, YPO2385, hmuR, flaA1a, and psaB) . While ArgO has not been specifically identified among these targets, its membrane localization and potential role in virulence make it a candidate worth investigating, particularly as part of multi-epitope constructs.

What are the approaches for investigating ArgO's role in Y. pestis pathogenesis and antibiotic resistance?

Investigating ArgO's role in pathogenesis and potential contribution to antibiotic resistance requires multiple complementary experimental approaches:

  • Gene Deletion and Complementation Studies:

    • Generate precise argO deletion mutants in Y. pestis using CRISPR-Cas9 or allelic exchange methods

    • Create complementation strains expressing ArgO from controlled promoters

    • Compare virulence properties between wild-type, deletion, and complementation strains

  • Transcriptomic and Proteomic Profiling:

    • Perform RNA-seq analysis comparing wild-type and ΔargO strains under various conditions

    • Use quantitative proteomics to identify changes in protein expression patterns

    • Focus analysis on virulence factors and antibiotic resistance determinants

  • Amino Acid Transport Assays:

    • Measure arginine uptake and efflux in wild-type versus ΔargO strains

    • Assess the impact of arginine analogues and antibiotics on transport dynamics

    • Determine if ArgO contributes to efflux of certain antibiotics, particularly those with basic chemical groups

  • Animal Infection Models:

    • Compare colonization and virulence of wild-type and ΔargO strains in appropriate animal models

    • Assess bacterial loads in tissues and survival rates

    • Evaluate antibiotic efficacy against both strains in vivo

  • Interaction Studies with Host Cells:

    • Investigate how arginine export affects bacterial survival within macrophages

    • Examine potential interference with host arginine-dependent antimicrobial mechanisms

This comprehensive approach can elucidate whether ArgO contributes to Y. pestis virulence through modulation of arginine levels, interference with host defense mechanisms, or potential contributions to antibiotic resistance through drug efflux capabilities.

What biosafety requirements must be followed when working with recombinant Y. pestis ArgO protein?

Working with recombinant Y. pestis ArgO protein requires adherence to specific biosafety protocols and regulatory frameworks:

  • Institutional Approval Requirements:

    • All research involving recombinant DNA from Y. pestis must be reviewed and approved by the Institutional Biosafety Committee (IBC) before initiation

    • The IBC will assess containment levels, facilities, procedures, practices, and personnel training

  • NIH Guidelines Classification:

    • Research with recombinant Y. pestis components typically falls under Section III-D of NIH Guidelines

    • Some experiments may require additional approvals from RAC (Recombinant DNA Advisory Committee) and NIH director

  • Biosafety Level Determination:

    • While purified recombinant ArgO protein alone may be handled at BSL-1, parent Y. pestis strains require BSL-3 facilities

    • Work with intact Y. pestis for source material isolation must be conducted in select agent-authorized BSL-3 laboratories

  • Documentation and Reporting Requirements:

    • Maintain detailed records of experimental protocols and safety measures

    • Report any accidents, spills, or potential exposures according to institutional and federal guidelines

    • Submit annual updates to the IBC regarding ongoing projects

  • Training Requirements:

    • All personnel must receive specialized training in biosafety procedures

    • Documentation of training must be maintained and updated regularly

These requirements ensure safe handling of materials derived from Y. pestis while preventing accidental release or exposure. Researchers should consult their institutional biosafety officers for specific local requirements that may exceed federal guidelines .

How should researchers analyze functional data from ArgO transport assays?

Analysis of ArgO transport assay data requires rigorous statistical approaches and careful interpretation:

  • Experimental Design Considerations:

    • Include appropriate controls: wild-type strains, known arginine transport mutants, and strains with vector-only constructs

    • Perform time-course experiments to capture kinetics of transport

    • Include multiple biological and technical replicates (minimum n=3)

  • Quantitative Analysis Methods:

    • Calculate initial transport rates using linear regression of early time points

    • Determine Km and Vmax values using Michaelis-Menten kinetics

    • Apply appropriate transformations (e.g., Lineweaver-Burk) to validate kinetic parameters

  • Comparative Analysis Framework:

    • Use ANOVA with post-hoc tests for comparing multiple conditions

    • Apply paired statistical tests when comparing the same strain under different conditions

    • Incorporate Bonferroni or similar corrections for multiple comparisons

  • Data Interpretation Guidelines:

    • Distinguish between direct effects on ArgO function versus indirect effects on expression

    • Consider how mutations in regulatory proteins (e.g., ArgP) affect transport data

    • Evaluate potential confounding factors such as effects on cell membrane integrity

  • Presentation Standards:

    • Present transport data as pmol substrate/min/mg protein

    • Include error bars representing standard deviation or standard error

    • Provide clear descriptions of statistical significance criteria

This analytical framework ensures robust interpretation of ArgO functional data and facilitates comparison with other amino acid transporters in the literature.

What are the most informative structural analysis techniques for studying ArgO protein conformation?

Understanding the structure-function relationship of ArgO requires multiple complementary structural biology approaches:

  • Computational Structure Prediction:

    • Utilize homology modeling based on related transporters like LysE from C. glutamicum

    • Apply molecular dynamics simulations to predict conformational changes during transport

    • Use coevolutionary analysis to identify functionally coupled residues

  • Experimental Structure Determination:

    • X-ray crystallography of purified ArgO in appropriate detergent micelles or lipidic cubic phase

    • Cryo-electron microscopy for visualization of ArgO in near-native environments

    • NMR spectroscopy for dynamics studies of specific domains

  • Topology Mapping Techniques:

    • Cysteine accessibility methods to determine membrane-spanning regions

    • Fusion reporter assays (PhoA/LacZ) to map protein topology relative to membrane

    • Site-directed spin labeling coupled with EPR spectroscopy for dynamic studies

  • Functional Correlation Approaches:

    • Alanine-scanning mutagenesis to identify critical residues

    • Cross-linking studies to capture different conformational states

    • Fluorescence resonance energy transfer (FRET) to monitor conformational changes

  • Data Integration Framework:

    • Develop comprehensive structural models incorporating all experimental constraints

    • Correlate structural features with transport kinetics data

    • Identify potential binding sites for arginine and regulatory molecules

Given that ArgO is a relatively small transport protein (205 amino acids in Y. pestis bv. Antiqua) , it presents both challenges and opportunities for structural studies. The small size may facilitate NMR studies but could complicate crystallization efforts due to lower hydrophobic surface area for crystal contacts.

How can researchers address common challenges in ArgO protein expression and purification?

When encountering difficulties with ArgO expression and purification, researchers should implement the following troubleshooting strategies:

  • Low Expression Yield Problems:

    • Optimize codon usage for E. coli expression systems

    • Test different promoter strengths and induction conditions

    • Consider fusion partners that enhance solubility (e.g., MBP, SUMO)

    • Evaluate expression in specialized E. coli strains (C41/C43) designed for membrane proteins

  • Protein Aggregation Issues:

    • Reduce induction temperature to 16-20°C

    • Screen multiple detergents for membrane extraction

    • Add stabilizing agents such as glycerol (5-50%) and trehalose (6%)

    • Consider adding arginine to buffers as a potential substrate stabilizer

  • Purification Challenges:

    • For His-tagged constructs with low affinity, adjust imidazole concentrations in binding and washing buffers

    • If protein precipitates during concentration, reduce concentration rate and add stabilizers

    • Consider on-column detergent exchange during purification

    • Implement quality control at each purification step via activity assays

  • Storage Stability Problems:

    • Aliquot purified protein to avoid freeze-thaw cycles

    • Store working aliquots at 4°C for up to one week

    • For long-term storage, add glycerol (5-50%) and store at -20°C/-80°C

    • Validate protein activity after storage periods

  • Analytical Approaches for Troubleshooting:

    • Use size exclusion chromatography to assess oligomeric state

    • Apply circular dichroism to confirm proper folding

    • Employ limited proteolysis to identify stable domains

Implementing these strategies systematically can overcome common challenges associated with membrane protein work and improve the likelihood of obtaining functional recombinant ArgO protein.

What are the methodological considerations for designing ArgO mutants to study structure-function relationships?

Designing ArgO mutants for structure-function studies requires careful planning and execution:

  • Rational Mutation Site Selection:

    • Target conserved residues identified through multiple sequence alignment of ArgO homologs

    • Focus on charged residues in predicted transmembrane domains that may form substrate binding sites

    • Create alanine substitutions of potential substrate coordination residues

    • Consider the 205-amino acid sequence of Y. pestis ArgO for comprehensive coverage

  • Mutation Strategy Design:

    • Use site-directed mutagenesis for specific substitutions

    • Create scanning libraries (alanine or cysteine) for systematic analysis

    • Design chimeric proteins with related transporters to identify functional domains

    • Create truncations to determine minimal functional units

  • Validation Approaches:

    • Express mutants in ΔargO backgrounds to avoid wild-type interference

    • Confirm proper expression and membrane localization before functional analysis

    • Perform parallel transport assays under identical conditions for valid comparisons

    • Conduct complementary binding assays to separate effects on binding versus transport

  • Experimental Controls:

    • Include conservative mutations (e.g., Asp to Glu) as controls for charge preservation

    • Create both loss-of-function and gain-of-function controls

    • Use mutations in known transport proteins as reference points

  • Data Interpretation Framework:

    • Classify mutations based on effects on Km (binding) versus Vmax (catalysis)

    • Map mutations onto structural models to identify functional domains

    • Consider how mutations might affect interactions with regulatory proteins like ArgP

This methodical approach will generate meaningful structure-function data that can advance understanding of ArgO's transport mechanism and potentially inform therapeutic strategies targeting Y. pestis.

What emerging technologies could advance our understanding of ArgO's role in bacterial physiology and pathogenesis?

Several cutting-edge technologies present opportunities for deeper insights into ArgO function:

  • CRISPR Interference/Activation Systems:

    • Implement CRISPRi for titratable repression of argO expression

    • Use CRISPRa to upregulate argO in various conditions

    • Apply in combinatorial screens with other transporters to identify functional interactions

  • Single-Cell Technologies:

    • Employ microfluidics to monitor real-time arginine transport in individual cells

    • Use single-cell RNA-seq to identify heterogeneity in argO expression within populations

    • Apply correlative light and electron microscopy to visualize ArgO localization and dynamics

  • Advanced Imaging Techniques:

    • Implement super-resolution microscopy to study ArgO clustering and localization

    • Use fluorescent arginine analogs to track transport in real-time

    • Apply label-free techniques like Raman microscopy for metabolite tracking

  • Systems Biology Approaches:

    • Develop comprehensive metabolic models incorporating ArgO function

    • Apply flux balance analysis to predict impacts of ArgO modulation

    • Integrate multi-omics data to position ArgO within global regulatory networks

  • Therapeutic Development Platforms:

    • Screen for small molecule inhibitors of ArgO using high-throughput transport assays

    • Apply fragment-based drug design targeting ArgO binding sites

    • Develop ArgO-targeting peptides as potential antimicrobial agents

These technological advances could transform our understanding of ArgO's physiological roles beyond simple arginine export, potentially revealing unexpected functions in bacterial adaptation to host environments or antibiotic resistance mechanisms.

How might researchers integrate ArgO studies into broader investigations of Yersinia pestis pathogenesis mechanisms?

Integrating ArgO research into comprehensive Y. pestis pathogenesis studies requires strategic approaches:

  • Infection Model Integration:

    • Assess argO expression dynamics during different stages of infection

    • Compare argO regulation between flea vector and mammalian host environments

    • Evaluate ΔargO mutant performance in pneumonic versus bubonic plague models

  • Host-Pathogen Interaction Studies:

    • Investigate how arginine export affects Y. pestis interactions with macrophages

    • Examine potential interference with host arginine-dependent immune pathways

    • Determine if ArgO contributes to bacterial survival in neutrophil extracellular traps

  • Multi-Component Analysis Frameworks:

    • Study ArgO in context with other Y. pestis transporters and metabolic systems

    • Examine potential regulatory cross-talk between ArgO and established virulence factors

    • Investigate metabolic interactions between ArgO and the type III secretion system

  • Comparative Pathogenesis Approaches:

    • Compare argO function across Y. pestis biovars (Antiqua, Medievalis, Orientalis)

    • Examine evolutionary changes in argO between Y. pestis and related species

    • Assess conservation of argO regulation across pathogenic Yersinia species

  • Therapeutic Development Integration:

    • Evaluate ArgO as a potential component in multi-epitope vaccine constructs

    • Consider ArgO inhibitors as adjuvants to conventional antibiotics

    • Assess ArgO-targeting strategies in combination with other virulence inhibitors

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.