Recombinant Yersinia pestis bv. Antiqua Bifunctional protein aas (aas)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Full Length Yersinia pestis bv. Antiqua Bifunctional protein Aas(Aas) Protein, His-Tagged, is a protein expressed in E. coli . The protein, tagged with N-terminal His, is derived from the Yersinia pestis bv. Antiqua species and is a full-length protein consisting of 718 amino acids .

Characteristics:

  • Source: E. coli

  • Tag: His

  • Protein Length: Full Length (1-718 aa)

  • Form: Lyophilized powder

  • Purity: Greater than 90% as determined by SDS-PAGE

  • UniProt ID: Q1CAS8

Gene Information

The gene name for this protein is aas . Synonyms include aas, YPA_0476, and Bifunctional protein Aas, which encompasses several activities such as 2-acylglycerophosphoethanolamine acyltransferase, 2-acyl-GPE acyltransferase, Acyl-[acyl-carrier-protein]--phospholipid O-acyltransferase, Acyl-[acyl-carrier-protein] synthetase, Acyl-ACP synthetase, and Long .

Function and Significance

The bifunctional protein Aas exhibits multiple enzymatic activities, primarily related to lipid metabolism . These activities include:

  • 2-acylglycerophosphoethanolamine acyltransferase activity

  • Acyl-[acyl-carrier-protein] synthetase activity

  • Acyl-[acyl-carrier-protein]--phospholipid O-acyltransferase activity

These functions suggest a role in the synthesis and modification of phospholipids, which are crucial components of bacterial membranes .

Recombinant Production and Quality Control

Recombinant proteins are produced in controlled facilities using well-established technologies to ensure batch-to-batch consistency and experiment reproducibility . The protein can be produced with or without a His-Tag or other tag, according to customer specifications .

Quality control measures include:

  • Purity Assessment: Greater than 90% as determined by SDS-PAGE

  • Storage Conditions: Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles .

  • Storage Buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0

  • Reconstitution: Briefly centrifuge the vial before opening. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding 5-50% glycerol (final concentration) and aliquoting is recommended for long-term storage at -20℃/-80℃ .

Applications

Recombinant Yersinia pestis bv. Antiqua Bifunctional protein Aas (Aas) can be utilized in various applications, including:

  • ELISA as a positive control

  • IFA (Immunofluorescence Assay)

  • RIA (Radioimmunoassay)

  • Western Blot

Glutathionylation of Yersinia pestis Proteins

LcrV, a secreted protein of Yersinia pestis, undergoes glutathionylation at Cys273, which influences its interaction with host ribosomal protein S3 (RPS3) . This modification affects Y. pestis type III effector transport, macrophage killing, and bubonic plague pathogenesis in mice and rats . Mutating Cys273 to Ala (lcrVC273A) enhances animal survival in bubonic plague models .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to ensure contents settle. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To ensure your specified tag, please communicate your requirements for preferential development.
Synonyms
aas; YpAngola_A3246; Bifunctional protein Aas [Includes: 2-acylglycerophosphoethanolamine acyltransferase; 2-acyl-GPE acyltransferase; Acyl-[acyl-carrier-protein]--phospholipid O-acyltransferase; Acyl-[acyl-carrier-protein] synthetase; Acyl-ACP synthetase; Long-chain-fatty-acid--[acyl-carrier-protein] ligase]
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-718
Protein Length
full length protein
Species
Yersinia pestis bv. Antiqua (strain Angola)
Target Names
aas
Target Protein Sequence
MAYRLLRALFRGLFRVTIDGVTDQFKHEKLIITPNHVSFLDGALLALFLPIKPVFAVYTS ITDTWYMRWLKPYVDFVALDPTNPMAIKHLVRMVEQGRPVVIFPEGRITVTGSLMKIYDG AAFVAAKSGAAVVPIRLDGPEFTHFGRLQGVLKTRWFPKISIHVLPATTIPMPQAPRSRE RRVLAGEHLHTIMMAARMATVPRETLFEALLSAQTRYGRFKPCIEDVSFKEDSYQTLLKK TLGVSRILQRFTVPGEHVGMLLPNATITAAAIFGASLRGRIPALLNYTSGAKGLQSAIIA ASLKTIVTSRQFLEKGKLTHLPEQVNEVNWVYLEDLKDTVTLTDKLWILFHLCFPRRAML PQQADDSALILFTSGSEGNPKGVVHSHASLLANVEQIRTIADFTPRDRFMSSLPLFHAFG LTVGLFTPLMTGSRVFLYPSPLHYRVVPELVYDRNCTVLFGTSTFLGNYARFAHPYDFAR VRYVVAGAEKLAESTKQIWQDKFGIRILEGYGVTECAPVVAINVPMAAKVNTVGRILPGM EARLINVPGIAQGGRLQLRGPNIMRGYLRVENPGVLEQPSAENAQGELDANWYDTGDIVT LDEQGFCAIRGRVKRFAKLAGEMVSLESVEQLAISLSPEGQHAAAAKTDSAKGEALVLFT TDSEITRERLIKVARENGVPELAVPRDIRVVKALPLLGSGKPDFVTLGKMAQDPEMSV
Uniprot No.

Target Background

Function

This bifunctional protein plays a crucial role in lysophospholipid acylation. It catalyzes the transfer of fatty acids to the 1-position of lysophospholipids via an enzyme-bound acyl-ACP intermediate, requiring ATP and magnesium. Its primary physiological function is the regeneration of phosphatidylethanolamine from 2-acyl-glycero-3-phosphoethanolamine (2-acyl-GPE), a byproduct of transacylation reactions or phospholipase A1 degradation.

Database Links
Protein Families
2-acyl-GPE acetyltransferase family; ATP-dependent AMP-binding enzyme family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the bifunctional protein Aas in Yersinia pestis?

The Aas protein in Yersinia pestis is a bifunctional enzyme that exhibits both 2-acyl-glycerophosphoethanolamine (2-acyl-GPE) acyltransferase and acyl-acyl carrier protein (acyl-ACP) synthetase activities . The full-length protein consists of 718 amino acids and plays an important role in phospholipid metabolism. Its primary function in bacterial metabolism is to act as a salvage pathway for resynthesizing phosphatidylethanolamine from 2-acyl-GPE, which may be taken up from the medium or arise from the activity of phospholipase A1 or the transfer of 1-position acyl moieties during membrane protein acylation . The protein represents an important component in Y. pestis membrane lipid homeostasis.

What is the molecular structure and key features of the Yersinia pestis Aas protein?

The Aas protein in Y. pestis has a full length of 718 amino acids (residues 1-718) with a molecular weight of approximately 80 kDa. The protein contains a conserved histidine residue (H36) that is essential for its acyltransferase activity . The amino acid sequence includes characteristic motifs that are associated with both its acyltransferase and synthetase functions. The protein has a conserved HX₄D pattern that appears critical for catalytic activity, with the histidine functioning as a general base to deprotonate the hydroxyl moiety of the acyl acceptor during the acyltransferase reaction . For recombinant expression purposes, the protein can be successfully produced with an N-terminal His tag in E. coli expression systems .

How does recombinant Aas protein stability compare with native protein?

Recombinant Y. pestis Aas protein expressed with a His tag in E. coli requires specific handling to maintain stability. The recombinant protein is typically stored in a Tris/PBS-based buffer with 6% trehalose at pH 8.0 . Multiple freeze-thaw cycles significantly reduce protein activity and stability, so working aliquots should be stored at 4°C for up to one week, while long-term storage requires -20°C to -80°C conditions . When reconstituting lyophilized protein, using deionized sterile water to a concentration of 0.1-1.0 mg/mL is recommended, with addition of 5-50% glycerol (typically 50% final concentration) for long-term storage aliquots . Unlike membrane-bound native Aas, the recombinant version may exhibit altered kinetic properties due to the absence of its native lipid environment, similar to observations with related membrane-associated enzymes like PlsB .

What are the recommended protocols for expressing and purifying recombinant Aas protein?

For successful expression and purification of recombinant Y. pestis Aas protein, an E. coli expression system with an N-terminal His tag is recommended . The following methodological approach has proven effective:

  • Expression Vector Selection: Use a pET-based vector system with a strong T7 promoter for controlled expression.

  • Host Strain: BL21(DE3) or Rosetta(DE3) E. coli strains are suitable for managing the hydrophobic nature of the protein.

  • Culture Conditions: Grow transformed cells at 37°C until OD600 reaches 0.6-0.8, then induce with 0.5-1 mM IPTG at a reduced temperature of 16-18°C for 16-20 hours to enhance proper folding of this membrane-associated protein.

  • Lysis Buffer: Use 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, 1 mM DTT, and 1% detergent (such as n-dodecyl-β-D-maltoside) with protease inhibitors.

  • Purification: Perform immobilized metal affinity chromatography using Ni-NTA resin, followed by size exclusion chromatography to obtain >90% purity as determined by SDS-PAGE .

  • Quality Control: Verify protein identity using western blotting and mass spectrometry.

The final purified protein should be stored with 6% trehalose and/or 50% glycerol to maintain stability during storage at -80°C .

How can researchers accurately assess the dual enzymatic activities of the Aas protein?

Measuring both enzymatic activities of the bifunctional Aas protein requires distinct assay methods:

For 2-acyl-GPE acyltransferase activity:

  • Prepare a reaction mixture containing purified Aas protein, radioactively labeled acyl donor ([¹⁴C]acyl-CoA or [¹⁴C]acyl-ACP), and 2-acyl-GPE substrate in an appropriate buffer system.

  • Incubate at 30-37°C for 15-30 minutes.

  • Extract phospholipids using chloroform:methanol (2:1) solution.

  • Separate reaction products by thin-layer chromatography.

  • Quantify incorporated radioactivity using phosphorimaging or scintillation counting.

For acyl-ACP synthetase activity:

  • Combine purified Aas protein with fatty acids, ATP, Mg²⁺, and ACP in an appropriate buffer.

  • Incubate the reaction at 30-37°C for 30 minutes.

  • Analyze acyl-ACP formation using either:

    • Conformationally-sensitive PAGE (native-PAGE) that can distinguish between acylated and non-acylated ACP

    • HPLC analysis of reaction products

    • Pyrophosphate release assays that measure ATP consumption

When analyzing mutant proteins like Aas[H36A], it is crucial to test both activities separately to determine the specific impact of mutations on each function. For instance, the H36A mutation eliminates acyltransferase activity while retaining significant synthetase activity, demonstrating the independent nature of these catalytic functions .

What are effective strategies for site-directed mutagenesis of critical Aas residues?

Site-directed mutagenesis of Aas can be effectively performed using the following approach, based on successful studies of the conserved histidine residue:

  • Primer Design: Design mutagenic primers that contain the desired nucleotide change(s) with approximately 15 nucleotides of perfectly matched sequence on both sides of the mutation. For studying the conserved histidine within the HX₄D motif, target the corresponding codon for substitution with alanine (e.g., CAC→GCC for H36A) .

  • PCR Method Selection: Either use:

    • QuikChange site-directed mutagenesis for simple substitutions

    • Overlap extension PCR (SOE-PCR) for more complex modifications, similar to the approach used in related protein mutation studies

  • Template Selection: Use a previously cloned wild-type aas gene in a suitable vector (e.g., pBluescript II KS(+) as used for similar work) .

  • Verification Steps:

    • Confirm successful introduction of mutation by DNA sequencing

    • Create appropriate restriction enzyme sites without altering the amino acid sequence to facilitate screening

    • Verify expression of the mutant protein by western blot analysis

  • Functional Validation: Compare wild-type and mutant protein activities using the dual enzymatic assays described earlier to determine the specific effects of the mutation. As demonstrated with the H36A mutation, this approach can effectively separate the functions of the bifunctional enzyme .

This methodology has successfully identified that the invariant histidine functions as a general base in the acyltransferase reaction mechanism while having minimal impact on the synthetase activity .

What are the methodological challenges in studying membrane-associated proteins like Aas?

Studying membrane-associated proteins like Y. pestis Aas presents several methodological challenges:

  • Protein Solubilization and Purification:

    • Membrane proteins are often difficult to solubilize while maintaining native structure and function

    • Detergent selection is critical - too harsh and the protein denatures, too mild and it remains aggregated

    • Purified membrane proteins may exhibit altered kinetic properties compared to their membrane-bound native forms, as observed with related proteins like PlsB

  • Structural Analysis Limitations:

    • The hydrophobic character of membrane-associated proteins makes them difficult to crystallize

    • The need to reconstitute isolated enzymes in phospholipid bilayers or detergent micelles represents a major impediment to obtaining crystals for high-resolution structure determination

    • NMR studies are complicated by size limitations and the presence of detergent micelles

  • Functional Assay Design:

    • Acyltransferase activity requires presentation of lipid substrates in a membrane-like environment

    • Ensuring proper orientation and accessibility of the active site in artificial systems

    • Maintaining enzyme stability throughout the assay procedure

  • Expression Challenges:

    • Overexpression of membrane proteins can be toxic to host cells

    • Proper folding and membrane insertion may require specific chaperones or insertion machinery

    • The need for post-translational modifications may limit heterologous expression options

These challenges can be addressed through careful optimization of detergent conditions, consideration of nanodiscs or liposome reconstitution systems, and the use of functional assays that accommodate the membrane-associated nature of the protein.

How can structural predictions inform the design of Aas inhibitors as potential antimicrobial agents?

The design of potential Aas inhibitors as antimicrobial agents can be informed by structural predictions through the following methodological approach:

  • Identification of Catalytic Residues: The conserved histidine (H36) in the HX₄D motif has been demonstrated to be essential for acyltransferase activity . This histidine functions as a general base to deprotonate the hydroxyl moiety of the acyl acceptor, making it a prime target for inhibitor design. Similarly, the conserved aspartic acid (comparable to D311 in the related PlsB protein) is crucial for both catalytic activity and proper protein folding .

  • Homology Modeling: In the absence of a crystal structure, homology models can be constructed based on related acyltransferases with known structures. Specifically:

    • Identify structural templates with similar HX₄D catalytic motifs

    • Generate models that predict the spatial arrangement of the active site residues

    • Refine models using molecular dynamics simulations in a simulated membrane environment

  • Virtual Screening Approach:

    • Perform in silico docking of compound libraries targeting the predicted active site

    • Prioritize compounds that can interact with the catalytic histidine and nearby residues

    • Filter candidates based on:

      • Predicted binding affinity to the active site

      • Interactions with catalytic residues

      • Drug-like properties and membrane permeability

      • Selectivity compared to human homologs

  • Rational Design Strategy:

    • Design transition state analogs that mimic the geometry and charge distribution of the acyltransfer reaction

    • Develop covalent inhibitors that can react with the catalytic histidine

    • Consider dual-function inhibitors that might target both enzymatic activities

  • Experimental Validation Pipeline:

    • Biochemical assays to confirm inhibition of the acyltransferase activity

    • Cellular assays to determine antimicrobial activity against Y. pestis

    • Structural studies (if possible) to confirm binding mode

    • Animal model testing to evaluate efficacy against Y. pestis infection

The unique bifunctional nature of Aas offers the possibility of developing inhibitors that could disrupt both lipid metabolism and fatty acid utilization, potentially creating a more effective antimicrobial strategy against Y. pestis.

How does Y. pestis Aas compare with homologous proteins in other bacterial species?

The Y. pestis Aas protein shares significant structural and functional similarities with homologous proteins in other bacterial species, but with some notable differences:

SpeciesAas HomologStructural SimilaritiesFunctional DifferencesNotes
E. coliAasContains conserved HX₄D motif; Similar bifunctional activityPotentially different substrate preferencesMost extensively studied homolog
Y. pseudotuberculosisAasHigh sequence identity (>97%); Same domain organizationLikely similar function due to close evolutionary relationshipEvolutionary precursor to Y. pestis
Y. enterocoliticaAasContains conserved catalytic residuesPotential differences in activity levels or regulationMore distantly related to Y. pestis
Other Gram-negative bacteriaVarious Aas homologsConservation of catalytic HX₄D motifVariation in substrate specificity and relative activity of two functionsPart of conserved glycerolipid acyltransferase family

The most significant conservation occurs in the catalytic domains, particularly the HX₄D motif where the histidine functions as a general base for acyltransferase activity across bacterial species . While the mechanistic principles are conserved, subtle variations in substrate binding regions may account for differences in activity or substrate preference that could be related to the specific membrane phospholipid composition requirements of different bacteria. These differences might be exploited for species-specific inhibitor design.

What methodological approaches can resolve contradictory data regarding Aas function?

When facing contradictory data regarding Aas function, researchers should employ the following methodological approach to resolve discrepancies:

  • Standardize Experimental Conditions:

    • Protein preparation methods: Ensure consistent purification protocols, tag positions, and storage conditions

    • Assay conditions: Standardize buffer composition, pH, temperature, and substrate concentrations

    • Expression systems: Compare protein expressed in different systems (E. coli vs. native host)

  • Separate and Independently Analyze Dual Functions:

    • The bifunctional nature of Aas means that experimental conditions optimized for one activity might not be suitable for the other

    • Use mutants like Aas[H36A] that selectively disrupt one function while preserving the other to isolate and study each activity independently

    • Develop assays specific to each function with appropriate controls

  • Membrane Context Analysis:

    • Compare activity in different membrane environments:

      • Detergent-solubilized protein

      • Reconstituted proteoliposomes

      • Native membrane preparations

    • Assess the impact of lipid composition on activity, as the proper LPS and phospholipid environment may be crucial for function, similar to observations with other Y. pestis membrane proteins like Ail

  • Cross-Laboratory Validation:

    • Implement round-robin testing with standardized protocols

    • Share reagents (plasmids, purified proteins, substrates) between laboratories

    • Use multiple, complementary detection methods for each activity

  • Comprehensive Mutational Analysis:

    • Beyond the key H36 residue, systematically mutate other conserved residues

    • Create chimeric proteins with domains from well-characterized homologs

    • Correlate structural predictions with functional outcomes of mutations

This systematic approach can help identify sources of experimental variation and resolve apparently contradictory results regarding Aas function.

How might Aas function be influenced by the unique lifecycle and environmental adaptations of Y. pestis?

The function of Aas is likely influenced by Y. pestis' unique lifecycle that involves transitions between mammalian hosts (primarily rodents) and flea vectors, as well as its ability to survive in diverse environmental conditions:

  • Temperature-Dependent Regulation and Activity:

    • Y. pestis experiences temperature shifts between flea vectors (~26°C) and mammalian hosts (37°C)

    • Aas activity may be modulated at different temperatures to optimize membrane fluidity

    • Research methodology: Comparative enzyme kinetics at 26°C vs. 37°C, coupled with transcriptomic analysis of aas expression under these conditions

  • Adaptation to Nutrient Availability:

    • In flea vectors, Y. pestis faces nutrient limitations different from those in mammalian blood

    • The salvage function of Aas may be particularly important for recycling phospholipids during nutrient limitation

    • Research methodology: Growth of Y. pestis wild-type vs. aas mutants under conditions mimicking flea gut vs. mammalian tissue environments

  • Response to Host Immune Defenses:

    • Mammalian hosts produce antimicrobial peptides that target bacterial membranes

    • Aas-mediated phospholipid remodeling might contribute to membrane integrity and resistance

    • Research methodology: Susceptibility testing of aas mutants to host antimicrobial peptides compared to wild-type

  • Biofilm Formation in Fleas:

    • Y. pestis forms biofilms in the flea gut that are crucial for transmission

    • Membrane composition, potentially influenced by Aas, might affect biofilm formation

    • Research methodology: Examination of biofilm formation capacity and structure in aas mutants

  • Interaction with Vector/Host Cell Membranes:

    • Membrane composition affects interactions with host cells during infection

    • Aas-mediated phospholipid recycling may influence membrane properties relevant to host-pathogen interactions

    • Research methodology: Cell adhesion and invasion assays comparing wild-type and aas mutants

Understanding these adaptations requires experimental designs that mimic the relevant aspects of Y. pestis' lifecycle phases and environmental transitions, ideally integrating both in vitro biochemical approaches and in vivo infection models.

What novel approaches could advance our understanding of Aas structure-function relationships?

Several innovative methodological approaches could significantly advance our understanding of Aas structure-function relationships:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Apply single-particle cryo-EM to determine the structure of Aas in detergent micelles or nanodiscs

    • Utilize advances in membrane protein cryo-EM to overcome the crystallization challenges inherent to membrane-associated proteins like Aas

    • Capture different conformational states by imaging the protein with various substrates or substrate analogs

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Map protein dynamics and substrate-induced conformational changes

    • Identify regions of Aas that become protected upon substrate binding

    • Compare dynamics between wild-type protein and catalytic mutants like H36A

  • Advanced Computational Approaches:

    • Apply molecular dynamics simulations in explicit membrane environments

    • Utilize quantum mechanics/molecular mechanics (QM/MM) calculations to model the catalytic mechanism in atomic detail

    • Implement machine learning approaches to predict impacts of mutations on activity based on sequence analysis of Aas homologs across bacterial species

  • In-Cell NMR and Cross-Linking Mass Spectrometry:

    • Study Aas structure and interactions in near-native cellular environments

    • Identify interacting proteins and map interaction surfaces

    • Determine if the two catalytic activities occur in distinct cellular compartments or contexts

  • Integration of Functional Genomics:

    • Apply CRISPR interference or similar approaches for partial gene silencing to study the impact of reduced Aas levels on Y. pestis physiology

    • Perform epistasis analysis with genes involved in related lipid metabolism pathways

    • Conduct global lipidomics analyses to comprehensively assess the impact of Aas mutations on bacterial membrane composition

These methodologies would provide complementary insights into both structural features and functional roles of Aas, potentially revealing novel aspects of its mechanism and biological importance.

What are the implications of Aas research for developing new plague treatments or vaccines?

Research on the Y. pestis Aas protein has several potential implications for developing new plague treatments or vaccines:

  • Antimicrobial Drug Development:

    • The essential role of Aas in phospholipid metabolism makes it a potential drug target

    • The conserved catalytic histidine represents a specific target for inhibitor design

    • Structure-based drug design or high-throughput screening could identify compounds that selectively inhibit Aas acyltransferase activity

    • Dual inhibitors targeting both enzymatic functions might be particularly effective

  • Attenuated Vaccine Development:

    • Aas mutants with reduced function might serve as attenuated live vaccine strains

    • Methodological approach: Create targeted aas mutations that reduce virulence without compromising immunogenicity

    • The bifunctional nature of the protein allows for selective mutation of one function while preserving the other, potentially creating balanced attenuation

  • Membrane-Focused Therapeutics:

    • Understanding how Aas contributes to membrane homeostasis could inform development of compounds that destabilize Y. pestis membranes

    • Combination therapies targeting both Aas and other membrane proteins like Ail might create synergistic antimicrobial effects

  • Diagnostic Applications:

    • Recombinant Aas protein could be used to develop serological tests for plague exposure

    • Methodology: Expression of full-length recombinant protein with appropriate tags for immobilization in diagnostic platforms

  • Adjuvant Development:

    • Lipid products of Aas activity might have immunomodulatory properties

    • Research approach: Testing purified or synthesized Y. pestis-specific phospholipids for adjuvant potential in vaccine formulations

Each of these potential applications requires rigorous validation through in vitro and in vivo studies, with careful attention to the challenges of targeting a membrane-associated protein and ensuring specificity for bacterial rather than host enzymes.

How might systems biology approaches enhance our understanding of Aas in the context of Y. pestis metabolism?

Systems biology approaches can provide comprehensive insights into Aas function within the broader context of Y. pestis metabolism:

  • Multi-omics Integration:

    • Combine transcriptomics, proteomics, and lipidomics data from wild-type and aas mutant strains

    • Methodological approach: Culture Y. pestis under various conditions (temperature shifts, nutrient limitation, host cell contact) and perform parallel -omics analyses

    • Construct correlation networks between Aas expression/activity and global metabolic changes

  • Metabolic Flux Analysis:

    • Use isotope-labeled precursors to track phospholipid synthesis and turnover rates

    • Compare flux distributions between wild-type and aas mutants

    • Identify compensatory pathways activated in response to aas mutation

    • Methodology: ¹³C-labeled glycerol or fatty acid tracing combined with mass spectrometry analysis

  • Genome-Scale Metabolic Modeling:

    • Incorporate Aas-catalyzed reactions into genome-scale metabolic models of Y. pestis

    • Predict system-wide effects of Aas inhibition or mutation

    • Identify potential synthetic lethal interactions with other metabolic genes

    • Method: Flux balance analysis with constraints derived from experimental data

  • Protein-Protein Interaction Networks:

    • Map the interactome of Aas using approaches like BioID or APEX proximity labeling

    • Identify potential regulatory proteins or multienzyme complexes involving Aas

    • Methodology: Express Aas fused to a proximity labeling enzyme in Y. pestis, followed by proteomic identification of labeled proteins

  • Host-Pathogen Interface Analysis:

    • Examine how Aas-dependent changes in membrane composition affect interactions with host cells

    • Study the impact of host lipids on Aas activity during infection

    • Method: Dual RNA-seq of host-pathogen interactions with wild-type vs. aas mutants

These systems approaches would contextualize Aas function within the broader metabolic network of Y. pestis and potentially reveal unexpected connections to other aspects of bacterial physiology and pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.