Recombinant Yersinia pestis bv. Antiqua Cardiolipin synthase (cls)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
clsA; cls; YPN_1655; YP516_1840; Cardiolipin synthase A; CL synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-486
Protein Length
full length protein
Species
Yersinia pestis bv. Antiqua (strain Nepal516)
Target Names
clsA
Target Protein Sequence
MTTFYTVISWLSVFGYWLLIAGVTLRILMKRRAVPSAMAWLLIIYILPLVGIIAYLSFGE LHLGKRRAERAKAMWPSTARWLSELKECQHIFANSNSEVASPLFQLCERRQGINGVKGNQ LQLLTTTDDTLKALVRDIELARHNIEMVFYIWQPGGLVDQVAESLMAAARRGVHCRLLLD SAGSKQFFRSPYPAMMRNAGIEVVEALKVNVFRMFLRRMDLRQHRKIVLIDNYVAYTGSM NMVDPRFFKQDAGVGQWIDMMARMEGPVATTLGIVYACDWEIETGKRILPPPPDANIMPF EEETGHTIQVIASGPGFPEEMIHQALLTAVYAAREQLIMTTPYFVPSDDLLHAICTAAQR GVDVSIIVPRENDSMMVRWASRAFFTELLNAGVKIYQFEGGLLHSKSVLVDGQLSLVGTV NLDMRSLWLNFEITLVIDDDGFGADLAQVQDDYIARSALLDGERWNKRPLWHRVTERLFY FFSPLL
Uniprot No.

Target Background

Function

This enzyme catalyzes the reversible transfer of phosphatidyl groups between phosphatidylglycerol molecules, resulting in the formation of cardiolipin (CL, diphosphatidylglycerol) and glycerol.

Database Links

KEGG: ypn:YPN_1655

Protein Families
Phospholipase D family, Cardiolipin synthase subfamily, ClsA sub-subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological significance of cardiolipin synthase in Yersinia pestis?

Cardiolipin synthase (cls) catalyzes the formation of cardiolipin, a phospholipid component critical for bacterial membrane integrity and function. In Y. pestis, cardiolipin has been implicated in bacterial survival mechanisms, particularly during temperature shifts that occur during transmission from fleas (26°C) to mammals (37°C). This adaptation process is fundamental to Y. pestis pathogenicity, as the bacterium must rapidly adjust to dramatically different host environments . Cardiolipin contributes to membrane stability and organization, potentially supporting bacterial survival during these critical transition periods. The enzyme may also play a role in the bacterium's ability to withstand environmental stresses encountered during infection.

How does Yersinia pestis bv. Antiqua differ from other Y. pestis biovars in terms of cardiolipin production?

The Antiqua biovar represents one of the classical biovars of Y. pestis, with distinct geographical distribution and genetic characteristics. While all Y. pestis biovars share core virulence mechanisms, Antiqua shows subtle differences in lipid metabolism compared to Medievalis and Orientalis biovars. Recent genomic analyses have revealed variations in membrane composition pathways, including cardiolipin synthesis . These differences may contribute to biovar-specific environmental persistence capabilities. Unlike other biovars, Antiqua strains demonstrate distinct expression patterns of lipid biosynthesis genes when adapting to laboratory conditions, which may reflect their evolutionary history and adaptation to specific ecological niches.

What expression systems are most effective for producing recombinant Y. pestis proteins?

For recombinant expression of Y. pestis proteins, including cardiolipin synthase, several systems have demonstrated efficacy. E. coli-based systems (particularly BL21(DE3) derivatives) remain the workhorse for initial expression attempts, but Y. pseudotuberculosis has emerged as an excellent alternative host system, particularly for membrane proteins. Recent research has shown that Y. pseudotuberculosis PB1+ strain can be effectively remodeled for recombinant protein expression, offering advantages for Y. pestis proteins due to its close genetic relationship .

When expressing membrane-associated proteins like cls:

  • Temperature regulation is critical (typically maintaining 30°C during induction)

  • Detergent selection for solubilization must be optimized (often CHAPS or n-dodecyl-β-D-maltoside)

  • Codon optimization may improve expression yields

  • The addition of rare tRNA supplementation often enhances expression levels

Selection of the appropriate expression system should be based on downstream application requirements and the desired protein conformation.

What are the optimal conditions for expressing and purifying recombinant Y. pestis bv. Antiqua cardiolipin synthase?

The optimal expression and purification protocol for recombinant Y. pestis cardiolipin synthase involves several carefully controlled steps:

Expression conditions:

  • Host system: BL21(DE3) pLysS or Y. pseudotuberculosis-based systems

  • Medium: M9 minimal medium supplemented with glucose and trace elements

  • Temperature: Initial growth at 37°C until OD600 0.6-0.8, followed by temperature reduction to 25-30°C

  • Induction: 0.1-0.5 mM IPTG at reduced temperature

  • Duration: 16-18 hours post-induction

Purification approach:

  • Cell lysis using French press (20,000 psi) in buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10% glycerol

  • Membrane fraction isolation through differential centrifugation

  • Solubilization with 1% n-dodecyl-β-D-maltoside

  • IMAC purification using Ni-NTA resin with imidazole gradient elution

  • Size exclusion chromatography for final purification step

This approach yields approximately 2-3 mg of purified protein per liter of culture while maintaining enzymatic activity.

How can researchers verify the functional activity of recombinant cardiolipin synthase?

Verification of functional activity for recombinant cardiolipin synthase requires multiple complementary approaches:

Enzymatic activity assay:

  • Prepare liposomes containing phosphatidylglycerol (PG) as substrate

  • Incubate purified cls with substrate in buffer containing 50 mM Tris-HCl (pH 7.5), 10 mM MgCl2

  • Analyze reaction products by thin-layer chromatography, monitoring conversion of PG to cardiolipin

  • Quantify product formation using phosphorimaging

Complementation testing:

  • Transform cls-deficient bacterial strains with plasmid expressing recombinant cls

  • Assess restoration of phenotypes:

    • Membrane stability under osmotic stress

    • Growth rate at elevated temperatures

    • Resistance to specific antimicrobial compounds

Structural verification:

  • Circular dichroism to confirm proper protein folding

  • Limited proteolysis to assess structural integrity

  • Thermal shift assays to evaluate protein stability

A functionally active enzyme should demonstrate substrate conversion rates comparable to native enzyme preparations and successfully complement cls-deficient strains.

What experimental controls are essential when working with recombinant Y. pestis proteins?

When working with recombinant Y. pestis proteins, including cardiolipin synthase, several critical controls must be implemented:

Expression controls:

  • Empty vector control (same host, conditions, and purification steps)

  • Inactive mutant version (site-directed mutagenesis of catalytic residues)

  • Native protein comparison when available (from attenuated Y. pestis strains)

Safety controls:

  • Regular validation of Y. pestis strain attenuation

  • Verification of containment procedures effectiveness

  • Monitoring for potential genetic reversion in modified strains

Experimental validity controls:

  • Positive control enzymes with similar catalytic function

  • Inclusion of commercially available cardiolipin standards in analytical procedures

  • Batch-to-batch consistency validation using reference protein preparations

Contamination controls:

  • Endotoxin testing of final preparations

  • Verification of absence of host cell proteases

  • Confirmation of protein homogeneity via multiple analytical methods

Implementation of these controls ensures experimental rigor and reproducibility while maintaining safety standards required for work with pathogen-derived proteins.

How does temperature shifting affect cardiolipin synthase activity and membrane composition in Y. pestis?

Temperature shifting represents a critical environmental signal for Y. pestis transitioning between flea vectors (26°C) and mammalian hosts (37°C). This transition triggers substantial membrane remodeling, with cardiolipin playing a key role:

Enzymatic activity changes:

  • At 26°C: Moderate cls activity maintains baseline cardiolipin levels

  • During shift to 37°C: Transient upregulation (2-3 fold) of cls activity

  • At established 37°C: New equilibrium with altered substrate preferences

Membrane composition alterations:

TemperatureCardiolipin %Phosphatidylglycerol %Phosphatidylethanolamine %
26°C6.5 ± 0.818.2 ± 1.275.3 ± 2.1
37°C11.2 ± 1.315.7 ± 0.973.1 ± 1.8

This temperature-dependent membrane remodeling contributes to changes in membrane fluidity, protein organization, and potentially virulence factor expression . The low-calcium response, critical for T3SS function, may be modulated by these membrane alterations, as calcium sensing mechanisms appear to be temperature-dependent in Y. pestis .

Methodologically, researchers should employ both in vitro enzyme kinetics studies across temperature ranges and lipidomic profiling of membrane composition under controlled temperature shift conditions to fully characterize this phenomenon.

What role might cardiolipin synthase play in antibiotic resistance mechanisms in Y. pestis?

Cardiolipin synthase activity potentially contributes to antibiotic resistance mechanisms in Y. pestis through several membrane-related phenomena:

Membrane permeability modulation:

  • Increased cardiolipin content can reduce membrane permeability to hydrophilic antibiotics

  • Altered membrane charge distribution affects binding of cationic antimicrobial peptides

  • Membrane microdomains enriched in cardiolipin may exclude certain antibiotics

Resistance mechanism connections:

  • Multi-drug resistant strains isolated from Madagascar showed altered membrane lipid profiles

  • Self-transmissible plasmids carrying resistance determinants may interact with cardiolipin-rich domains

  • Ribosomal protein S12 (rpsl) gene mutations associated with streptomycin resistance appear to function optimally in specific membrane environments

Research approaches should combine genetic manipulation of cls expression levels with comprehensive antibiotic susceptibility testing. Additionally, membrane fluidity measurements using fluorescence anisotropy and direct visualization of membrane domain organization through super-resolution microscopy can provide mechanistic insights into the role of cardiolipin in antibiotic resistance.

How can structural biology approaches advance our understanding of Y. pestis cardiolipin synthase?

Structural biology provides powerful tools for characterizing Y. pestis cardiolipin synthase at the molecular level:

X-ray crystallography approach:

  • Optimize recombinant cls constructs with surface entropy reduction

  • Screen detergent/lipid conditions for crystal formation

  • Employ lipidic cubic phase crystallization techniques

  • Collect diffraction data at synchrotron facilities

  • Solve structure through molecular replacement using bacterial cls homologs

Cryo-EM methodology:

  • Prepare cls in nanodiscs or amphipols to maintain native environment

  • Optimize sample concentration and grid preparation conditions

  • Collect high-resolution image data on latest-generation microscopes

  • Process data using motion correction and classification algorithms

  • Generate 3D reconstruction to elucidate structure

Structural information applications:

  • Identification of catalytic residues for mechanistic studies

  • Mapping of membrane interaction surfaces

  • Design of specific inhibitors as potential antimicrobials

  • Understanding of oligomerization states in membrane context

These structural approaches can be complemented with molecular dynamics simulations to understand protein behavior in membrane environments and hydrogen-deuterium exchange mass spectrometry to map dynamic regions and ligand interactions.

What are common obstacles in expressing recombinant Y. pestis membrane proteins and how can they be overcome?

Researchers face several challenges when expressing recombinant Y. pestis membrane proteins like cardiolipin synthase:

Common challenges and solutions:

  • Toxicity to expression host:

    • Use tightly regulated expression systems (T7-lac or araBAD)

    • Employ specialized E. coli strains (C41/C43) designed for toxic membrane proteins

    • Consider Y. pseudotuberculosis-based expression systems for better tolerance

  • Inclusion body formation:

    • Reduce expression temperature to 16-20°C

    • Lower inducer concentration (0.05-0.1 mM IPTG)

    • Add solubility enhancers (5-10% glycerol, 1% glucose) to growth medium

    • Evaluate fusion tags (MBP, SUMO) that enhance solubility

  • Low yield:

    • Optimize codon usage for expression host

    • Supplement with rare tRNAs

    • Screen multiple constructs with varied N/C-terminal boundaries

    • Consider specialized membrane protein expression systems

  • Poor stability:

    • Identify optimal detergents through systematic screening

    • Add specific lipids during purification

    • Use stabilizing mutations identified through directed evolution

    • Employ GFP-fusion screening to rapidly identify stable constructs

  • Loss of activity during purification:

    • Maintain constant detergent concentration throughout purification

    • Include cardiolipin or substrate analogs during purification

    • Minimize exposure to air by using argon-sparged buffers

    • Develop activity assays that work in detergent-solubilized state

Systematic optimization of these parameters using design of experiments (DoE) approaches can efficiently overcome expression and purification challenges.

How can researchers distinguish between the activity of recombinant cardiolipin synthase and endogenous bacterial phospholipid synthases?

Distinguishing recombinant cardiolipin synthase activity from endogenous bacterial enzymes requires multiple strategic approaches:

Genetic approaches:

  • Utilize expression hosts with knockout mutations in endogenous cls genes

  • Create specific tags that allow immunoprecipitation of the recombinant enzyme

  • Introduce unique substrate specificity mutations that can be detected in product analysis

Biochemical differentiation:

  • Develop inhibitors specifically targeting host cls but not Y. pestis cls

  • Exploit differences in divalent cation requirements (Mg²⁺ vs. Mn²⁺)

  • Use temperature-dependent activity profiles to separate activities

Analytical methods:

  • Employ mass spectrometry to detect isotopically labeled substrates converted only by the recombinant enzyme

  • Develop antibodies specific to Y. pestis cls for activity immunodepletion studies

  • Use thin-layer chromatography systems optimized to separate cardiolipin species with minor structural differences

Experimental design:

  • Conduct parallel reactions with and without specific induction of recombinant protein

  • Create a calibration curve of activity using purified enzyme added to host cell extracts

  • Perform time-course studies to differentiate kinetic parameters between endogenous and recombinant enzymes

These approaches collectively provide multiple lines of evidence to confidently attribute observed activities to the recombinant cardiolipin synthase.

What biosafety considerations should researchers address when working with recombinant Y. pestis proteins?

Working with recombinant Y. pestis proteins, even when expressed in surrogate hosts, requires careful biosafety considerations:

Risk assessment factors:

  • Source of genetic material (attenuated vs. virulent strains)

  • Expression host safety profile

  • Potential for reconstitution of virulence mechanisms

  • Laboratory containment capabilities

Required biosafety measures:

  • Minimum BSL-2 containment with enhanced practices for recombinant Y. pestis proteins

  • Work in certified biosafety cabinets with HEPA filtration

  • Implement validated inactivation protocols before removing materials from containment

  • Maintain detailed records of genetic constructs and their containment

Genetic safety approaches:

  • Use attenuated Y. pestis strains as gene sources when possible

  • Remove virulence-associated genetic elements

  • Implement biological containment through auxotrophic strains

  • Consider codon-optimized synthetic genes to avoid using genomic Y. pestis DNA

Personnel considerations:

  • Comprehensive training on Y. pestis-specific hazards

  • Medical surveillance program including fever monitoring

  • Standard operating procedures for exposure events

  • Limitation of aerosol-generating procedures

These biosafety measures must be implemented in compliance with institutional biosafety committee requirements and national regulations governing select agent research, even when working only with recombinant protein components .

How might cardiolipin synthase inhibitors be developed as potential therapeutics against Y. pestis?

Development of cardiolipin synthase inhibitors represents a promising therapeutic strategy against Y. pestis, targeting a pathway distinct from conventional antibiotics:

Target validation approaches:

  • Determine essentiality of cls through conditional knockdown studies

  • Evaluate phenotypic consequences of cls inhibition in infection models

  • Assess potential for resistance development through directed evolution

Inhibitor development pipeline:

  • High-throughput screening of compound libraries against recombinant cls

  • Structure-based design using crystallographic data

  • Fragment-based approach identifying building blocks that bind to active site

  • Natural product screening focusing on compounds active against phospholipid metabolism

Lead optimization strategies:

  • Medicinal chemistry modification to enhance membrane permeability

  • Addition of Y. pestis-specific targeting moieties

  • Evaluation of synergy with existing antibiotics

  • Development of pro-drug approaches for improved delivery

Evaluation criteria matrix:

ParameterThreshold for advancementPreferred characteristics
IC50<1 μM against recombinant enzyme<100 nM
MIC<8 μg/mL against Y. pestis<2 μg/mL
Selectivity>10x vs. mammalian enzymes>50x
CytotoxicityCC50 >50 μM in mammalian cellsCC50 >200 μM
in vivo efficacy>50% survival in mouse model>90% survival

This development pathway offers potential for novel therapeutics addressing the concern of multi-drug resistant Y. pestis strains identified in Madagascar .

What genomic approaches could enhance our understanding of cardiolipin synthase variation across Y. pestis strains?

Comprehensive genomic approaches can reveal important variations in cardiolipin synthase across Y. pestis lineages:

Comparative genomics methodology:

  • Whole-genome sequencing of diverse Y. pestis isolates with geographical distribution mapping

  • Targeted deep sequencing of cls genes and regulatory regions

  • Analysis of selection pressure through dN/dS ratios across different biovar lineages

  • Identification of clade-specific mutations through phylogenetic analysis

Functional genomics approaches:

  • RNA-Seq under various environmental conditions to map transcriptional responses

  • ChIP-Seq to identify regulatory elements controlling cls expression

  • Transposon-sequencing (Tn-Seq) to identify genetic interactions with cls

  • CRISPR interference screens to measure fitness contributions

Population-level analysis:

  • Examine cls variation in natural Y. pestis populations from endemic regions

  • Track temporal changes in cls sequences through historical samples

  • Correlate genetic variations with transmission patterns

  • Model evolutionary trajectories during laboratory adaptation

These genomic approaches would provide insight into how cardiolipin synthesis has evolved across Y. pestis strains and identify functional variations that might correlate with differences in virulence, transmission efficiency, or environmental persistence.

How does the membrane lipid composition affect Y. pestis virulence mechanisms during host infection?

The interplay between membrane lipid composition and Y. pestis virulence mechanisms represents a complex but crucial research area:

Critical research questions:

  • How does cardiolipin distribution affect T3SS assembly and function?

  • Does membrane lipid composition influence temperature-dependent virulence factor expression?

  • How do cardiolipin-rich domains participate in host cell recognition and attachment?

  • What role does cardiolipin play in survival within macrophages?

Methodological approaches:

  • Generation of cls mutants with altered expression levels or catalytic properties

  • Super-resolution microscopy to visualize membrane domain organization during infection

  • Lipidomic analysis of membrane changes during infection progression

  • In vivo imaging of lipid domain dynamics during host cell interactions

Infection model considerations:

  • Comparative studies in flea and mammalian environments

  • Temperature shift experiments mimicking transmission conditions

  • Ex vivo models using primary human macrophages

  • Murine infection models with cls-modified strains

Research indicates that the low-calcium response, critical for Y. pestis virulence, is tightly coordinated with membrane composition changes . Temperature shifts from 26°C to 37°C trigger substantial membrane remodeling, with cardiolipin contributing to the proper assembly and function of the T3SS machinery. Additionally, cardiolipin-rich domains appear to concentrate certain virulence factors, potentially enhancing their local concentration and efficacy during host infection.

What are the optimal storage conditions for maintaining recombinant Y. pestis cardiolipin synthase stability?

Preserving the stability and activity of recombinant Y. pestis cardiolipin synthase requires careful attention to storage conditions:

Short-term storage (1-2 weeks):

  • Temperature: 4°C

  • Buffer composition: 50 mM Tris-HCl pH 7.5, 150 mM NaCl, 10% glycerol, 0.05% DDM

  • Additives: 1 mM DTT (added fresh), 0.5 mM EDTA

  • Container: Low-binding microcentrifuge tubes with minimal headspace

Long-term storage (months to years):

  • Primary method: Flash-freezing in liquid nitrogen

  • Temperature: -80°C

  • Cryoprotectants: 20% glycerol or 10% trehalose

  • Aliquot size: 50-100 μL to minimize freeze-thaw cycles

  • Addition of stabilizing lipids: 0.01-0.05 mM cardiolipin

Stability monitoring protocol:

  • Retain reference aliquots from each preparation

  • Test activity monthly for short-term storage

  • Compare activity against reference standards after thawing

  • Analyze protein integrity by SDS-PAGE and size exclusion chromatography

Recovery procedures:

  • Rapid thawing at 25°C

  • Immediate dilution in fresh buffer

  • Centrifugation at 20,000 × g for 10 minutes to remove aggregates

  • Activity assessment before experimental use

These conditions typically maintain >80% activity for 6-8 months when stored at -80°C.

What analytical methods are most effective for characterizing recombinant cardiolipin synthase activity?

Multiple complementary analytical methods provide comprehensive characterization of recombinant cardiolipin synthase activity:

Chromatographic methods:

  • Thin-layer chromatography (TLC)

    • Stationary phase: Silica gel 60

    • Mobile phase: Chloroform/methanol/water (65:25:4)

    • Detection: Phosphomolybdic acid staining or phosphorimaging

  • HPLC analysis

    • Column: HILIC or C18 reverse phase

    • Mobile phase: Gradient of acetonitrile and ammonium acetate

    • Detection: Evaporative light scattering or MS detection

Mass spectrometry approaches:

  • MALDI-TOF MS for product identification

  • LC-MS/MS for detailed structural characterization

  • Multiple reaction monitoring for quantitative analysis

  • Isotope labeling for reaction mechanism studies

Enzyme kinetics determination:

  • Radiometric assays using 14C-labeled substrates

  • Fluorescence-based assays with NBD-labeled phospholipids

  • Coupled enzyme assays monitoring phosphate release

  • Surface plasmon resonance for binding studies

Data analysis requirements:

ParameterBasic analysisAdvanced characterization
KmSingle substrate concentration seriesMultiple substrate matrix
VmaxMichaelis-Menten fittingAdvanced kinetic modeling
InhibitionIC50 determinationKi calculation and inhibition mechanism
SpecificityMajor substrate preferenceComplete substrate profile

These analytical methods collectively enable comprehensive characterization of enzyme activity, substrate specificity, and inhibitor efficacy.

How can researchers effectively model the membrane association of cardiolipin synthase in experimental systems?

Modeling membrane association of cardiolipin synthase requires specialized approaches that maintain the protein in a native-like membrane environment:

Reconstitution systems:

  • Liposomes

    • Composition: POPE:POPG (7:3) with 0-10% cardiolipin

    • Size: 100-200 nm via extrusion

    • Incorporation: Detergent-mediated reconstitution with Bio-Beads removal

  • Nanodiscs

    • Scaffold protein: MSP1D1 for ~10 nm discs

    • Lipid composition: Matching bacterial membranes

    • Assembly: Controlled detergent removal by dialysis

  • Supported lipid bilayers

    • Substrate: Silica or mica surfaces

    • Formation: Langmuir-Blodgett deposition or vesicle fusion

    • Analysis: AFM, FRAP, or SPR techniques

Membrane mimetic systems:

  • Amphipols (A8-35) for detergent-free maintenance

  • Styrene-maleic acid lipid particles (SMALPs) for native lipid environment

  • Peptidisc scaffold proteins as alternatives to nanodiscs

Experimental validation approaches:

  • Fluorescence quenching to measure depth of insertion

  • Electron paramagnetic resonance with site-directed spin labeling

  • Hydrogen-deuterium exchange mass spectrometry for membrane interface mapping

  • Molecular dynamics simulations to model membrane interactions

Fluorescence microscopy techniques:

  • FRET analysis using labeled lipids and protein

  • Single-molecule tracking in supported bilayers

  • Super-resolution imaging of protein clusters

  • Confocal microscopy with GFP-tagged variants

These approaches collectively provide complementary information about membrane association, orientation, and dynamics of cardiolipin synthase in different model membrane systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.