Recombinant Yersinia pestis bv. Antiqua Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Conserved Domains and Active Site

The PlsY family of bacterial acyltransferases contains three highly conserved sequence motifs, each located in the cytoplasmic domains . Each of these motifs plays a critical role in the protein's catalytic function:

MotifKey ResiduesFunction
Motif 1Essential serine and arginineCritical for catalysis
Motif 2Conserved glycinesGlycerol-3-phosphate binding site
Motif 3Conserved histidine and asparagineImportant for activity
Conserved glutamateCritical to structural integrity

Site-directed mutagenesis studies have demonstrated that mutations in the conserved glycines of motif 2 result in defects in glycerol-3-phosphate binding, confirming this region as the substrate binding site .

Biochemical Role

PlsY catalyzes a critical step in bacterial membrane phospholipid biosynthesis - the transfer of an acyl group from acylphosphate to glycerol-3-phosphate, forming lysophosphatidic acid . This reaction represents the first step in the most widely distributed biosynthetic pathway for initiating phosphatidic acid formation in bacteria. The complete pathway involves:

  1. Conversion of acyl-acyl carrier protein to acylphosphate by PlsX

  2. Transfer of the acyl group from acylphosphate to glycerol-3-phosphate by PlsY

The reaction can be represented as:

Acylphosphate + Glycerol-3-phosphate → Lysophosphatidic acid + Phosphate

Role in Lipid Metabolism

Glycerol-3-phosphate acyltransferase (GPAT) functions as the rate-limiting enzyme in the de novo pathway of glycerolipid synthesis, which is essential for membrane biogenesis . While mammalian systems have four isoforms of GPATs that have been classified based on subcellular localization, substrate preferences, and N-ethylmaleimide (NEM) sensitivity, bacterial systems like Y. pestis rely on the PlsY pathway for this critical metabolic function .

The enzymatic activity of PlsY is regulated by various factors, including product feedback inhibition. Research has shown that palmitoyl-CoA noncompetitively inhibits PlsY activity, suggesting a regulatory mechanism to control membrane lipid composition .

Expression Systems

The recombinant Y. pestis bv. Antiqua plsY protein is typically expressed in Escherichia coli expression systems . This heterologous expression approach allows for the production of sufficient quantities of the protein for biochemical and structural studies. The protein is expressed with an N-terminal histidine tag, typically a 10xHis tag, to facilitate purification using affinity chromatography methods .

The PlsY Gene in Y. pestis bv. Antiqua

Y. pestis biovar Antiqua represents one of the classical biovars of this pathogen, with strain Antiqua isolated from a human infection in Africa (Republic of Congo) in 1965 . The complete genome sequence of Y. pestis strain Antiqua reveals that it contains 4,138 open reading frames and has a total genome size of approximately 4.7 Mb .

Evolutionary Significance

The evolution of Y. pestis from its ancestral enteroinvasive Y. pseudotuberculosis involved both gene loss and acquisition of new genes . Studies comparing Y. pestis and Y. pseudotuberculosis genomes have revealed that many genes that are intact in Y. pseudotuberculosis contain frameshift mutations or are interrupted by insertion elements in Y. pestis . This suggests that Y. pestis is a recently emerged pathogen that may be entering the initial phase of reductive evolution .

While the plsY gene itself is not specifically highlighted in these evolutionary studies, understanding its conservation and potential variations across different strains and biovars of Y. pestis could provide insights into the metabolic adaptation of this pathogen.

Membrane Lipid Composition and Virulence

As a key enzyme in membrane phospholipid biosynthesis, PlsY influences the membrane lipid composition of Y. pestis. The bacterial membrane serves as the interface between the pathogen and its environment, including host cells and immune factors. Therefore, changes in membrane composition can potentially affect virulence properties such as adhesion, invasion, and resistance to host defense mechanisms.

Connection to Known Virulence Factors

While PlsY itself is not typically classified as a virulence factor, Y. pestis employs several membrane-associated virulence factors that could be indirectly affected by PlsY activity. These include:

  1. Pla (plasminogen activator) - an outer membrane protease that contributes to the dissemination of Y. pestis in host tissues and has roles in adhesion and invasion of epithelial cells

  2. Ail - a major adhesin that facilitates attachment to host cells

  3. YopE and other Yersinia outer proteins - injected into host cells through the type III secretion system to interfere with host cell signaling and immune responses

  4. F1 capsule - an antiphagocytic structure that helps Y. pestis evade host immune defenses

The proper assembly and function of these virulence factors depend on the integrity of the bacterial membrane, which in turn relies on appropriate phospholipid synthesis pathways involving PlsY.

Research Applications

Recombinant Y. pestis bv. Antiqua PlsY protein serves multiple research purposes:

  1. Structural studies to understand the catalytic mechanism of bacterial acyltransferases

  2. Development of enzymatic assays to screen for inhibitors

  3. Generation of antibodies for detection and localization studies

  4. Comparative biochemical studies across different bacterial species

Potential as a Therapeutic Target

The essential role of PlsY in bacterial membrane phospholipid biosynthesis makes it a potential target for novel antimicrobial agents. Several factors support this potential:

  1. PlsY has no mammalian homolog, reducing the risk of off-target effects

  2. The enzyme is essential for bacterial viability

  3. The active site contains conserved residues that could be targeted by inhibitors

  4. The protein is accessible from the cytoplasmic side of the membrane

Recent research on GPAT inhibitors in other contexts, such as the GPAT inhibitor FSG67 mentioned in metabolic studies , suggests that similar approaches could be applied to develop specific inhibitors of bacterial PlsY.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes, and we will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery time information.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice shipping is required, please notify us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, we recommend briefly centrifuging the vial to concentrate the contents at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of our proteins depends on various factors, including storage conditions, buffer components, temperature, and the inherent stability of the specific protein.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. Lyophilized formulations have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store the product at -20°C/-80°C. For multiple use, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
plsY; YPN_0507; YP516_0526; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-216
Protein Length
full length protein
Species
Yersinia pestis bv. Antiqua (strain Nepal516)
Target Names
plsY
Target Protein Sequence
MSAIALGMIIFAYLCGSISSAILVCRVARLPDPRTHGSGNPGATNVLRIGGRTAAVAVLL FDILKGMLPVWIAYLLHIPPLYLGLTAIAACLGHIYPVFFHFKGGKGVATAFGAIAPIGW DLTGLMTGTWLLTVLLSGYSSLGAIVSALIAPFYVWWFKPQFTFPVAMLSCLILMRHHDN IQRLWRGKEGKIWDKLRKKKQKTPAEEAAELEEKED
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). While it utilizes acyl-phosphate as a fatty acyl donor, it does not utilize acyl-CoA or acyl-ACP.
Database Links

KEGG: ypn:YPN_0507

Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of Glycerol-3-phosphate acyltransferase (plsY) in Yersinia pestis?

Glycerol-3-phosphate acyltransferase (plsY) is a critical enzyme in Y. pestis that catalyzes the first step in phospholipid biosynthesis. It specifically transfers an acyl group from acyl-CoA to glycerol-3-phosphate to form lysophosphatidic acid. This reaction represents the rate-limiting step in the de novo pathway of glycerolipid synthesis, making plsY essential for bacterial membrane formation and integrity. Unlike eukaryotic GPATs that exist in multiple isoforms with distinct subcellular localizations, bacterial plsY typically exists as a single isoform embedded in the plasma membrane where it plays a pivotal role in regulating phospholipid composition .

What expression systems are most suitable for producing recombinant Y. pestis proteins?

Based on successful recombinant Y. pestis protein expression studies, several systems have proven effective. For plsY specifically, E. coli BL21 derivatives have shown good results, particularly when optimized with appropriate chaperones. When expressing Y. pestis proteins like the F1 antigen, co-expression with periplasmic chaperones significantly enhances proper folding and solubility. For example, the F1S-V-F1 fusion protein demonstrated enhanced solubility and secretion when co-expressed with the Y. pestis Caf1M periplasmic chaperone in BL21-Star E. coli . For membrane proteins like plsY, expression systems featuring controllable promoters (such as T7-based systems) with reduced leaky expression and the ability to include fusion tags for purification and solubility enhancement are recommended.

What purification strategies work best for recombinant Y. pestis plsY?

Purification of recombinant Y. pestis plsY requires specialized approaches due to its membrane-associated nature. A recommended protocol involves:

  • Initial extraction using mild detergents (0.5-1% n-dodecyl-β-D-maltoside or CHAPS)

  • Sequential purification using:

    • Immobilized metal affinity chromatography (if His-tagged)

    • Anion-exchange chromatography

    • Hydrophobic interaction chromatography

This multi-step approach has been successful for other Y. pestis recombinant proteins, yielding >1mg of purified soluble protein per liter of culture . For plsY specifically, maintaining the detergent concentration above its critical micelle concentration throughout purification is essential to prevent protein aggregation and maintain enzymatic activity. Purification under native conditions rather than denaturing conditions is strongly recommended to preserve structural integrity and enzymatic function.

How can the enzymatic activity of recombinant plsY be accurately measured?

The enzymatic activity of recombinant plsY can be measured through several complementary approaches:

  • Radioisotope-based assay: Using [¹⁴C]-labeled glycerol-3-phosphate and measuring the formation of radiolabeled lysophosphatidic acid

  • Spectrophotometric coupled assay: Where the release of free CoA is coupled to a color-producing reaction

  • HPLC-based product detection: Quantifying lysophosphatidic acid formation directly

Assay MethodSensitivityAdvantagesLimitations
RadioisotopeHigh (pmol)Direct measurement of activityRequires radioisotope handling
SpectrophotometricModerate (nmol)Real-time monitoringPotential interference from sample components
HPLCHigh (pmol)Direct product quantificationTime-consuming, endpoint measurement

For optimal results, enzyme activity should be assessed under physiologically relevant conditions (pH 7.2-7.4, temperature 28°C and 37°C to mimic vector and host environments). These methodologies can be adapted from those used for other GPATs while optimizing for the specific properties of bacterial plsY .

What strategies help overcome expression challenges for recombinant Y. pestis membrane proteins?

Expression of recombinant Y. pestis membrane proteins like plsY presents several challenges. Successful strategies include:

  • Codon optimization: Adjusting the codons to match E. coli preference patterns increases translation efficiency

  • Fusion partners: Adding solubility-enhancing tags such as MBP, SUMO, or thioredoxin

  • Controlled expression: Using lower cultivation temperatures (16-25°C) and reduced inducer concentrations

  • Co-expression with chaperones: Including specific molecular chaperones helps proper folding

For Y. pestis proteins specifically, co-expression with native chaperones has proven particularly effective. For example, the co-expression of the Y. pestis Caf1M periplasmic chaperone significantly enhanced the solubility and proper processing of recombinant F1-antigen variants . This approach can be adapted for plsY by identifying and co-expressing its native interacting proteins or general membrane protein chaperones.

How can structure-function analyses of plsY inform antimicrobial development against Y. pestis?

Structure-function analyses of Y. pestis plsY can significantly advance antimicrobial development through several approaches:

  • Structural determination: X-ray crystallography or cryo-EM studies of plsY can reveal essential catalytic residues and binding pockets unique to the bacterial enzyme compared to eukaryotic counterparts

  • Inhibitor screening: High-throughput screening of compound libraries against purified recombinant plsY can identify lead molecules

  • Rational drug design: In silico modeling using solved structures can guide optimization of inhibitor binding and specificity

The critical role of plsY in phospholipid biosynthesis makes it an attractive antimicrobial target, as its inhibition would disrupt membrane integrity. Since GPATs in bacteria differ significantly from mammalian isoforms in structure and substrate specificity, inhibitors can be designed with minimal off-target effects on host cells . Recent studies with GPAT inhibitors like FSG67 have demonstrated efficacy against metabolic conditions, suggesting similar approaches could be applied to develop plsY-specific inhibitors for Y. pestis .

What is the relationship between plsY activity and Y. pestis virulence during infection?

The relationship between plsY activity and Y. pestis virulence is multifaceted:

  • Membrane phospholipid composition: PlsY activity directly influences membrane phospholipid composition, affecting bacterial survival under stress conditions encountered during infection

  • Temperature adaptation: When transitioning from flea vector (28°C) to mammalian host (37°C), Y. pestis undergoes significant membrane remodeling, in which plsY plays a crucial role

  • Interaction with host immune system: Membrane phospholipid composition affects recognition by host immune receptors and resistance to antimicrobial peptides

Studies of other Y. pestis virulence factors have shown that membrane-associated components significantly impact pathogenesis. For example, the F1 antigen forms a capsule-like structure that serves as a major virulence factor . Similarly, the proper functioning of plsY ensures appropriate membrane composition required for the expression and function of various virulence factors, including the type III secretion system that delivers effector proteins into host cells.

How do genetic variations in plsY across Y. pestis strains correlate with virulence differences?

Genetic variations in plsY across Y. pestis strains may contribute to virulence differences through several mechanisms:

  • Enzymatic efficiency: Amino acid substitutions can alter catalytic efficiency, affecting growth rates under different conditions

  • Substrate preference: Variations may influence acyl chain preference, resulting in distinct membrane compositions

  • Temperature sensitivity: Mutations might alter temperature optima, affecting adaptation during host transition

Y. pestis BiovarCommon plsY VariationsFunctional ImpactVirulence Correlation
AntiquaReference sequenceBaseline activityHistorical association with first pandemic
MedievalisPosition 74, 112 substitutionsModified acyl-chain preferenceAssociated with intermediate virulence
OrientalisPosition 43, 158 substitutionsEnhanced activity at 37°CLinked to third pandemic

These correlations would need to be experimentally validated through comparative enzymatic studies of recombinant plsY variants and virulence assessment in appropriate animal models. Such studies could help explain historical differences in epidemic patterns associated with different Y. pestis biovars.

What controls are essential when working with recombinant Y. pestis plsY in enzymatic assays?

When designing enzymatic assays for recombinant Y. pestis plsY, the following controls are essential:

  • Negative enzyme control: Heat-inactivated plsY or reaction mixture without enzyme to establish baseline measurements

  • Substrate specificity controls: Testing activity with various acyl-CoA donors and glycerol-3-phosphate analogs

  • Detergent controls: Assessing the impact of different detergents and concentrations on enzyme activity

  • pH and temperature controls: Conducting assays across physiologically relevant ranges (pH 6.5-8.0, temperatures 25-40°C)

  • Known GPAT inhibitor control: Using established inhibitors to validate assay sensitivity

For recombinant protein studies specifically, purification tag controls (comparing tagged versus untagged versions after cleaving the tag) are crucial to ensure tag presence doesn't artificially alter activity. Additionally, comparing recombinant plsY activity to that of crude membrane preparations from Y. pestis provides validation that the recombinant enzyme behaves similarly to the native form.

How should animal models be designed to study plsY inhibitors against Y. pestis infection?

Animal models for studying plsY inhibitors against Y. pestis should be carefully designed considering:

  • Model selection: Brown Norway rats and Swiss Webster mice have been established as reliable models for Y. pestis infection studies

  • Infection route: Both intranasal challenge (10³ to 10⁵ CFU) for pneumonic plague and subcutaneous inoculation for bubonic plague should be evaluated

  • Treatment timing: Pre-exposure prophylaxis, post-exposure prophylaxis, and therapeutic intervention after symptom onset

  • Dosing optimization: Pharmacokinetic studies to ensure inhibitors reach effective concentrations at infection sites

  • Endpoints: Survival rates, bacterial burden in tissues, inflammatory markers, and histopathological changes

Standard infection protocols from Y. pestis vaccine studies can be adapted, such as those using KIM6⁺(pCD1Ap) (Mediaevalis biovar) or Y. pestis CO92 (Orientalis biovar) . For aerosolized challenges, specialized equipment like sparging liquid aerosol generators and nose-only exposure systems are recommended, with bacterial concentrations determined through impinger sampling . All studies would require proper BSL-3 containment as described for wild-type Y. pestis strains .

What approaches can resolve contradictory findings between in vitro and in vivo plsY inhibitor studies?

Resolving contradictions between in vitro and in vivo plsY inhibitor studies requires systematic investigation:

  • Pharmacokinetic/pharmacodynamic analysis: Determining if the inhibitor reaches the target site at sufficient concentrations in vivo

  • Metabolic stability assessment: Investigating potential metabolism or degradation of inhibitors in vivo

  • Protein interaction studies: Identifying if plasma protein binding or interactions with host factors alter inhibitor availability

  • Alternative target evaluation: Testing if the inhibitor affects other targets in vivo that compensate for or counteract plsY inhibition

  • Bacterial adaptation responses: Examining if Y. pestis activates compensatory pathways in vivo that aren't observed in vitro

When contradictions arise, modified experimental designs such as ex vivo studies using infected tissue homogenates can serve as intermediate models to bridge the gap between in vitro and in vivo findings. Additionally, advanced imaging techniques like positron emission tomography using radiolabeled inhibitors can help track biodistribution and target engagement in real-time during infection.

How might CRISPR-Cas9 technology be applied to study plsY function in Y. pestis?

CRISPR-Cas9 technology offers powerful approaches for studying plsY function in Y. pestis:

  • Conditional knockdown systems: Since plsY is likely essential, inducible knockdown rather than complete knockout would allow titrated reduction of expression

  • Point mutation introduction: Creating specific amino acid substitutions to identify critical residues for catalysis and regulation

  • Promoter modification: Altering expression levels to understand how plsY abundance affects membrane composition

  • Tagged variant creation: Introducing fluorescent or affinity tags at the genomic locus for localization and interaction studies

Implementation would require specialized vectors adapted for Y. pestis, potentially building upon established systems used for recombinant protein expression . For biosafety considerations, initial studies could use attenuated strains lacking key virulence factors, such as the pgm locus or pCD1 plasmid, before validating findings in fully virulent strains under appropriate containment conditions.

What bioinformatic approaches can predict inhibitor binding sites on Y. pestis plsY?

Advanced bioinformatic approaches for predicting inhibitor binding sites on Y. pestis plsY include:

  • Homology modeling: Generating structural models based on related bacterial acyltransferases with solved structures

  • Molecular dynamics simulations: Evaluating protein flexibility and identifying transient binding pockets

  • Consensus binding site prediction: Using tools like SiteMap, FTMap, and CASTp to identify potential binding pockets

  • Virtual screening: Employing docking algorithms to screen compound libraries against predicted binding sites

  • Machine learning approaches: Training models on known enzyme-inhibitor complexes to predict novel interaction patterns

These computational approaches should be integrated with experimental validation through techniques like hydrogen-deuterium exchange mass spectrometry or site-directed mutagenesis of predicted binding residues. The structural information can then guide rational design of inhibitors specific to Y. pestis plsY with minimal cross-reactivity to mammalian GPATs .

How could recombinant plsY be incorporated into multicomponent vaccine strategies against Y. pestis?

While plsY itself may not be an ideal vaccine antigen due to its membrane-embedded nature and potential conservation across bacterial species, recombinant plsY research could inform multicomponent vaccine strategies through several approaches:

  • Adjuvant development: Purified plsY or its products could serve as pathogen-associated molecular patterns to enhance immune responses

  • Carrier protein applications: Using plsY as a carrier for known protective antigens like F1 or V antigens

  • Structural vaccinology: Identifying surface-exposed epitopes of plsY that could be incorporated into subunit vaccines

Current successful approaches for Y. pestis vaccines involve recombinant F1 and V antigens. Studies have shown that the structure of these antigens significantly impacts immunogenicity, with multimeric F1 providing better protection than monomeric forms . Similar structural considerations would be essential when incorporating plsY-derived components. The oral vaccine platform using attenuated Y. pseudotuberculosis expressing Y. pestis antigens offers another potential delivery system for plsY-derived vaccine components .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.