Recombinant Yersinia pestis bv. Antiqua Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we will prioritize shipping the format currently in stock, please specify your format preference during order placement for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please specify this in your order; we will prioritize its inclusion.
Synonyms
mscL; YpAngola_A0611; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-137
Protein Length
full length protein
Species
Yersinia pestis bv. Antiqua (strain Angola)
Target Names
mscL
Target Protein Sequence
MSFMKEFREFAMRGNVVDLAVGVIIGAAFGRIVSSLVADIIMPPLGLLLGGVDFKQFHFV LRAAEGTIPAVVMNYGTFIQSIFDFVIVALAIFSAVKLMNKLRREKAEEEPATPPAPTTE EILLAEIRDLLKAQHTK
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a role in regulating cellular osmotic pressure changes.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological significance of the mechanosensitive channel (mscL) in Yersinia pestis virulence?

Basic Research Question

While specific data on the mscL channel in Y. pestis bv. Antiqua is limited in current literature, mechanosensitive channels are critical membrane proteins that respond to changes in membrane tension. In gram-negative bacteria like Y. pestis, these channels serve as emergency release valves during osmotic downshock, preventing cell lysis by allowing rapid efflux of cytoplasmic solutes when bacteria transition between environments of different osmolarity .

In pathogenic bacteria such as Y. pestis, which must transition between arthropod vectors (fleas) and mammalian hosts, mechanosensitive channels likely play crucial roles in adaptation to these dramatically different osmotic environments. The bacterium must survive the transition from the flea's midgut to mammalian tissue or bloodstream, where osmotic conditions differ significantly . The mscL channel may be particularly important during early infection stages when Y. pestis experiences environmental stress.

What experimental approaches are most effective for expressing and purifying recombinant Y. pestis proteins?

Basic Research Question

For recombinant Y. pestis proteins, a methodological approach similar to that used for F1 antigen can be applied to mscL channels:

  • Expression system selection: The use of Escherichia coli expression systems with appropriate promoters (T7, tac) allows for controlled expression of Y. pestis proteins.

  • Purification strategy: For the F1 antigen, researchers successfully employed ammonium sulfate fractionation followed by FPLC Superose gel filtration chromatography . For membrane proteins like mscL:

    • Detergent solubilization (typically with n-dodecyl-β-D-maltoside or LDAO)

    • Affinity chromatography using polyhistidine tags

    • Size exclusion chromatography for final purification

  • Protein characterization: Multiple techniques are required to verify structure and function:

    • FPLC gel filtration chromatography and capillary electrophoresis to determine oligomeric states

    • Circular dichroism to monitor secondary structure and conformational changes

    • Functional assays specific to the protein (for mscL, patch-clamp electrophysiology)

How does the oligomeric structure of recombinant Y. pestis proteins affect their functionality?

Advanced Research Question

Research on the F1 antigen demonstrates that oligomerization significantly impacts protein functionality and immunogenicity. Studies have shown that:

  • The F1 antigen naturally exists as a high molecular weight multimer

  • This multimer dissociates when heated in the presence of SDS

  • Reassociation occurs upon removal of SDS, which can be monitored using circular dichroism

In immunization studies, the oligomeric state dramatically affected protective efficacy:

F1 Antigen FormImmune ResponseProtection RateChallenge Dose
Monomeric rF1Similar to multimeric14.3% (1/7)1 × 10^6 cfu Y. pestis
Multimeric rF1Similar to monomeric71.4% (5/7)1 × 10^6 cfu Y. pestis

This data demonstrates that while both forms elicited comparable immune responses, the multimeric form provided significantly better protection . For mscL channels, which naturally function as pentameric complexes, ensuring proper oligomerization would be critical for both structural studies and potential vaccine development.

What are the key considerations in designing attenuated Y. pestis strains for vaccine research?

Advanced Research Question

Development of attenuated Y. pestis or related Yersinia strains involves multiple strategic considerations:

  • Mutation selection: Effective attenuation requires careful selection of deletion targets:

    • Essential virulence genes (e.g., yopK, yopJ)

    • Metabolic genes (e.g., asd) for balanced attenuation without compromising immunogenicity

    • Toxin-encoding genes to ensure safety

  • Antigen delivery strategy: For maximum efficacy, consider:

    • Chromosomal insertion of key antigen operons (e.g., caf1R-caf1M-caf1A-caf1 for F1 production)

    • Plasmid-based expression systems for flexible antigen combination (e.g., pYA5199 for LcrV delivery)

    • Type 3 secretion system (T3SS) for direct antigen delivery to host cells

  • Vaccination protocol optimization:

    • Single dose vs. prime-boost strategies

    • Administration route (oral vaccination shows particular promise)

    • Timing between doses (significant increases in both humoral and cellular immunity observed with prime-boost approaches)

Research data demonstrates that prime-boost immunization protocols significantly enhance protection:

Immunization StrategyAntibody ResponseT-cell ResponseProtection
Single doseModerateLower CD4+ and CD8+ T cells producing IFN-γ, IL-17A, or TNF-αPartial
Prime-boostElevatedSignificantly higher CD4+ and CD8+ T cells with cytokine productionComplete protection against high-dose challenge

What infectious dose parameters are critical when designing Y. pestis challenge studies?

Basic Research Question

When designing challenge studies for evaluating vaccines or therapeutics against Y. pestis, researchers must consider several parameters related to infectious dose:

  • Route-dependent variation: The infectious dose varies significantly based on exposure route:

    • Aerosol infectious dose (pneumonic plague): Estimated between 100-15,000 organisms in humans

    • Flea bite infectious dose (bubonic plague): Unknown in humans, but estimated at 11,000-24,000 CFU regurgitated by infected fleas

  • Animal model selection: Different animal models require different challenge doses and exhibit varying susceptibility:

    • Mice: Commonly used for initial vaccine studies

    • Brown Norway rats: Used for validating findings in a different species

    • Non-human primates (cynomolgus macaques, rhesus macaques, African green monkeys): Most predictive of human response

  • Challenge dose standardization: For comparability between studies:

    • Define dose in colony-forming units (CFU)

    • Document strain virulence characteristics

    • Use consistent delivery methods (intranasal, aerosol)

In vaccine studies, challenge doses of 1 × 10^6 CFU have been used to rigorously test protection efficacy .

How does Y. pestis adapt to different host environments at the molecular level?

Advanced Research Question

Y. pestis must adapt to dramatically different environments during its transmission cycle, which involves molecular adaptations across multiple systems:

  • Temperature-dependent gene regulation:

    • At flea temperature (20-28°C): Expression of biofilm-forming genes and murine toxin

    • At mammalian temperature (37°C): Expression of F1 capsule, T3SS, and various Yersinia outer proteins (Yops)

  • Iron acquisition systems:

    • Expression of siderophores in iron-limited environments

    • Regulation through Fur (ferric uptake regulator) protein

  • pH and osmotic adaptation:

    • Mechanosensitive channels like mscL likely play key roles in adaptation to osmotic shifts

    • pH-dependent gene regulation important during transition from flea (pH ~6.8) to early phagosome (pH ~6.0) to mature phagolysosome (pH ~4.5)

  • Nutrient acquisition shifts:

    • Metabolic reprogramming between arthropod and mammalian hosts

    • Carbon source utilization differences

Each of these adaptive mechanisms represents a potential target for therapeutic intervention or attenuated vaccine development.

What are the latest methodologies for studying bacterial membrane protein function in Y. pestis?

Advanced Research Question

For membrane proteins like mscL in Y. pestis, several cutting-edge methodologies are particularly valuable:

  • Structural analysis techniques:

    • Cryo-electron microscopy for high-resolution structures without crystallization

    • X-ray crystallography for atomic-level details of purified protein

    • Molecular dynamics simulations to understand channel gating and ion permeation

  • Functional characterization:

    • Patch-clamp electrophysiology for direct measurement of channel activity

    • Fluorescence-based techniques for monitoring membrane potential or solute flux

    • Osmotic shock survival assays to assess channel function in vivo

  • Protein-protein interaction studies:

    • Pull-down assays to identify interaction partners

    • Bacterial two-hybrid systems adapted for membrane proteins

    • Chemical crosslinking followed by mass spectrometry

  • In vivo significance assessment:

    • Gene knockout and complementation studies

    • Site-directed mutagenesis to identify critical residues

    • Virulence assessment in animal models using defined mutants

These approaches can be applied to understand how mscL channels contribute to Y. pestis adaptation and potentially identify novel therapeutic targets.

How can researchers effectively measure immune responses to Y. pestis antigens?

Basic Research Question

A comprehensive assessment of immune responses to Y. pestis antigens requires multiple methodological approaches:

  • Antibody response assessment:

    • ELISA for quantifying antigen-specific IgG, IgM, and IgA levels

    • Western blot for confirming antibody specificity

    • Neutralization assays to determine functional antibody activity

  • Cellular immunity measurement:

    • Flow cytometry to quantify:

      • Antigen-specific CD4+ and CD8+ T cells

      • Cytokine production (IFN-γ, IL-17A, TNF-α)

      • Multiple cytokine co-expression (polyfunctionality)

    • ELISpot assays for enumerating cytokine-producing cells

    • In vitro stimulation assays using purified antigens or whole-cell lysates

Research with Y. pestis vaccines has demonstrated that protection correlates with:

  • High titers of antibodies against F1 and LcrV antigens

  • Strong CD4+ and CD8+ T cell responses with IFN-γ, IL-17A, and TNF-α production

  • CD4+ IFN-γ+ T cells coexpressing either IL-17A or TNF-α

What strategies exist for enhancing immunogenicity of recombinant Y. pestis antigens?

Advanced Research Question

Several approaches have proven effective for enhancing the immunogenicity of Y. pestis antigens:

  • Structural optimization:

    • Maintaining native multimeric structure (as demonstrated with F1 antigen)

    • Fusion protein designs incorporating multiple protective epitopes

    • Rational protein engineering to expose key epitopes

  • Delivery system selection:

    • Live attenuated vectors (Y. pseudotuberculosis with triple mutation Δasd ΔyopK ΔyopJ)

    • Type 3 secretion systems for direct cytosolic delivery

    • Prime-boost strategies with heterologous delivery platforms

  • Adjuvant incorporation:

    • Alum-based adjuvants for enhanced antibody responses

    • TLR agonists for balanced Th1/Th17 responses

    • Cytokine co-delivery for specific immune profile shaping

  • Administration route optimization:

    • Oral delivery for mucosal immunity (particularly important for respiratory protection)

    • Intranasal delivery for direct respiratory tract immunization

    • Parenteral routes for systemic immunity

Research shows that prime-boost strategies with properly structured antigens provide superior protection compared to single immunizations or improperly folded antigens .

How do mechanosensitive channels contribute to bacterial stress responses?

Basic Research Question

Mechanosensitive channels like mscL function as cellular safety valves during osmotic stress through several mechanisms:

  • Osmotic downshock response:

    • When bacteria experience sudden decrease in external osmolarity, water influx causes increased turgor pressure

    • mscL channels open at membrane tensions approaching lytic levels

    • Channel opening allows rapid efflux of cytoplasmic solutes, preventing cell lysis

    • For Y. pestis transitioning between vector and host, this mechanism may be essential for survival

  • Secondary functions in stress adaptation:

    • Potential roles in small molecule secretion

    • Contribution to membrane protein insertion

    • Involvement in biofilm formation

  • Regulatory interactions:

    • Integration with other stress response systems

    • Potential interactions with virulence regulation networks

Understanding these mechanisms in Y. pestis could reveal how the bacterium manages the dramatic environmental transitions required during its infectious cycle between fleas and mammals, potentially identifying new therapeutic targets.

What techniques are most effective for studying gene expression changes in Y. pestis during host transitions?

Advanced Research Question

Several complementary techniques provide insights into Y. pestis gene expression during host transitions:

  • Transcriptomic approaches:

    • RNA-seq for comprehensive gene expression profiling

    • Quantitative RT-PCR for targeted gene expression analysis

    • Single-cell RNA-seq for heterogeneity assessment within bacterial populations

  • Proteomic methods:

    • Mass spectrometry-based proteomics for global protein expression

    • Targeted proteomics for specific pathways

    • Protein localization studies using fluorescent reporters

  • In vivo expression technology:

    • Reporter gene fusions (e.g., GFP, luciferase) for real-time monitoring

    • Recombination-based in vivo expression technology (RIVET)

    • Transcriptional terminators with selectable markers

  • Environmental condition simulation:

    • Temperature shifts (28°C to 37°C) to mimic flea-to-mammal transition

    • pH changes to simulate phagolysosomal environment

    • Nutrient limitation models

    • Controlled osmolarity changes to study mechanosensitive channel activation

These approaches can help identify when and how mscL and other stress response systems are activated during Y. pestis infection cycles.

What are the primary challenges in developing effective therapeutics targeting Y. pestis membrane proteins?

Advanced Research Question

Developing therapeutics targeting Y. pestis membrane proteins such as mscL presents several methodological challenges:

  • Target accessibility issues:

    • Membrane proteins are partially embedded in lipid bilayers

    • The gram-negative cell envelope provides multiple permeability barriers

    • Peptidoglycan layer restricts access of larger molecules

  • Structural characterization difficulties:

    • Membrane proteins are challenging to express and purify in active form

    • Crystal structures are more difficult to obtain than for soluble proteins

    • Native lipid environment is critical for proper function

  • Selective targeting requirements:

    • High sequence and structural similarity between bacterial and human mechanosensitive channels

    • Need for bacterial-specific binding sites to avoid host toxicity

    • Structure-based drug design complicated by conformational dynamics

  • Resistance development potential:

    • Mutations in channel structures may confer resistance

    • Alternative osmotic regulation systems may compensate

    • Biofilm formation may limit therapeutic access

Addressing these challenges requires integrated approaches combining structural biology, medicinal chemistry, and microbial physiology to develop effective, selective therapeutics against Y. pestis membrane proteins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.