Recombinant Yersinia pestis bv. Antiqua Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Yersinia pestis bv. Antiqua Lipoprotein Signal Peptidase (lspA)

Recombinant Yersinia pestis bv. Antiqua Lipoprotein Signal Peptidase (lspA) is a genetically engineered enzyme derived from the lipoprotein signal peptidase gene (lspA) of the Y. pestis Angola strain (biovar Antiqua). This enzyme plays a critical role in bacterial lipoprotein processing by cleaving the signal peptide from prolipoproteins during their maturation, a step essential for bacterial membrane protein assembly and virulence .

Gene and Protein Overview

  • Gene name: lspA (Ordered locus: YpAngola_A0789) .

  • Protein name: Lipoprotein signal peptidase (EC 3.4.23.36), also known as signal peptidase II (SPase II) .

  • UniProt ID: A9R007 .

Role in Lipoprotein Processing

lspA cleaves the signal peptide from prolipoproteins after the attachment of a diacylglyceryl group by phosphatidylglycerol:prolipoprotein diacylglyceryl transferase (Lgt). This cleavage generates mature lipoproteins anchored to bacterial membranes .

Catalytic Mechanism

  • Active site: Two conserved aspartates (Asp residues) form a catalytic dyad.

  • Mechanism: Functions as an aspartyl protease, utilizing a water molecule to hydrolyze the peptide bond between the signal peptide and mature lipoprotein .

Diagnostic and Immunological Studies

Recombinant lspA is used in ELISA-based assays to study antibody responses in plague-infected hosts. For example:

ApplicationDetails
ELISA antigenDetects anti-lspA antibodies in serum samples .
Expression hostProduced in Escherichia coli with Tris-based buffer and 50% glycerol .

Functional and Evolutionary Studies

  • Comparative genomics: lspA homologs in Yersinia species share >98% sequence identity, indicating evolutionary conservation .

  • Antibiotic resistance research: lspA is a target for globomycin and myxovirescin (TA), antibiotics that inhibit lipoprotein processing .

Role in Y. pestis Pathogenicity

  • Temperature-dependent activity: Y. pestis lspA activity may adapt to host environments (e.g., flea vectors vs. mammalian hosts) .

  • Immune evasion: Lipoproteins processed by lspA contribute to Y. pestis immune evasion by modulating Toll-like receptor (TLR) signaling .

Comparative Analysis Across Yersinia Species

FeatureY. pestis lspAY. pseudotuberculosis lspA
Gene homology98–100%98–100%
Lipoprotein substratesVirulence-associated (e.g., Pla, Ail)Similar substrates
Antibiotic sensitivitySensitive to TA/globomycinSensitive to TA/globomycin

Challenges and Future Directions

  • Functional redundancy: Y. pestis may encode additional peptidases compensating for lspA inhibition .

  • Therapeutic potential: Targeting lspA could disrupt lipoprotein-dependent virulence mechanisms, offering a novel antibiotic strategy .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate any specific format preferences. Please indicate your desired format in the order notes, and we will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time estimates.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, briefly centrifuge the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to minimize freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type in mind, please communicate your preference, and we will prioritize its development.
Synonyms
lspA; YpAngola_A0789; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-169
Protein Length
full length protein
Species
Yersinia pestis bv. Antiqua (strain Angola)
Target Names
lspA
Target Protein Sequence
MNKPICSTGLRWLWLAVVVVILDISSKQWVMAHFALYESVPLIPFFNLTYAQNFGAAFSF LADKSGWQRWFFAGIAIGISVVLMVMMYRSTAKQRLINCAYALIIGGALGNLYDRLVHGA VNDFLDFYINNWHFPTFNLADVAICIGAALVIFEGFLSPVEKNAVNNDE
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Lipoprotein signal peptidase (lspA) in Yersinia pestis bv. Antiqua?

Lipoprotein signal peptidase (lspA) in Yersinia pestis bv. Antiqua is a crucial enzyme (EC 3.4.23.36) responsible for processing prolipoproteins by cleaving signal peptides from substrate lipoproteins during their maturation. This membrane-embedded protease specifically recognizes and cleaves the signal peptide after lipid modification of the conserved cysteine residue in the lipobox motif. In Yersinia pestis, proper processing of lipoproteins by lspA contributes to bacterial membrane integrity, virulence factor delivery, and potentially immune evasion mechanisms .

How does lspA contribute to the pathogenicity of Yersinia pestis?

LspA contributes to Y. pestis pathogenicity through several mechanisms:

  • Membrane integrity maintenance: By processing lipoproteins that maintain outer membrane structure, lspA indirectly contributes to serum resistance, which is crucial for Y. pestis survival in host blood and tissues .

  • Lipoprotein maturation: LspA processes lipoproteins that may be involved in immune evasion, such as those that interact with host complement components. Proper processing of lipoproteins like Ail contributes to the bacterium's ability to resist complement-mediated lysis .

  • LPS processing and structure: Although indirect, lspA's role in processing membrane proteins can affect LPS structure, which is a major pathogenicity factor that contributes to Y. pestis virulence and immune evasion .

  • Temperature-dependent pathogenicity: The function of processed lipoproteins may be affected by temperature, contributing to the bacterium's ability to transition between flea vectors (26°C) and mammalian hosts (37°C), influencing virulence expression in different environments .

What methodologies are recommended for expressing and purifying recombinant Y. pestis lspA?

Expression system recommendations:

Expression SystemAdvantagesChallengesSpecial Considerations
E. coli BL21(DE3)High yield, established protocolsPotential toxicity, membrane protein challengesUse low IPTG concentrations (0.1-0.5 mM), low temperature induction (16-20°C)
Cell-free systemsAvoids toxicity issues, good for membrane proteinsLower yield, higher costConsider adding liposomes or nanodiscs for proper folding
Yeast expression (P. pastoris)Better for membrane proteins, post-translational modificationsLonger processOptimize methanol induction protocols

Purification methodology:

  • Membrane fraction isolation: Lyse cells by sonication or French press in buffer containing 20 mM Tris-HCl pH 8.0, 150 mM NaCl, protease inhibitors.

  • Solubilization: Extract membrane proteins using detergents such as n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG) at 1-2% concentration.

  • Affinity purification: Using His-tag or other fusion tags, purify on appropriate resin with detergent-containing buffers.

  • Size exclusion chromatography: Further purify and assess oligomeric state using appropriate columns.

  • Storage: Store in Tris-based buffer with 50% glycerol at -20°C for extended stability .

How does lspA processing affect lipopolysaccharide (LPS) structure and function in Y. pestis?

LspA does not directly modify LPS but affects LPS structure and function through multiple indirect mechanisms:

  • Lipoprotein-LPS interactions: LspA processes lipoproteins that may interact with and stabilize LPS in the outer membrane. Proper LPS organization contributes to Y. pestis serum resistance and immune evasion .

  • LPS biosynthetic enzyme processing: Some enzymes involved in LPS modification are lipoproteins that require lspA for proper maturation. Defects in lspA could potentially affect LPS biosynthesis pathway enzymes.

  • Temperature-dependent modifications: Y. pestis LPS structure varies based on temperature. At 37°C (mammalian host), Y. pestis produces LPS forms with specific modifications to the core oligosaccharide and lipid A. LspA-processed lipoproteins may be involved in these temperature-responsive modifications .

  • Immune recognition effects: LPS from Y. pestis contains a core oligosaccharide bound to lipid A without an O-antigen polysaccharide chain, distinguishing it from LPS of other Yersinia species. This structure, potentially influenced by lspA-processed proteins, affects host immune recognition and bacterial virulence .

What role might lspA inhibition play in developing novel antimicrobial strategies against Y. pestis?

LspA inhibition offers promising antimicrobial potential through several mechanisms:

  • Disruption of membrane integrity: Inhibiting lspA would prevent proper processing of multiple lipoproteins, potentially compromising membrane structure and function.

  • Attenuation of virulence: Unprocessed lipoproteins may disrupt virulence factor secretion and function, reducing pathogenicity.

  • Increased susceptibility to host defenses: Y. pestis with impaired lspA function would likely show reduced resistance to complement-mediated killing and other innate immune mechanisms .

  • Synergistic therapy potential: LspA inhibitors could be combined with conventional antibiotics to enhance efficacy, particularly against antibiotic-resistant strains.

Experimental approaches for lspA inhibitor development:

ApproachMethodologyReadoutsAdvantages
High-throughput screeningTest compound libraries against purified lspAFluorogenic substrate cleavageLarge-scale screening capacity
Structure-based designIn silico screening based on lspA structureBinding affinity predictionsRational design approach
Peptide-based inhibitorsDesign peptides mimicking lspA substratesGrowth inhibition, lipoprotein processingHigh specificity potential
Natural product screeningTest extracts from various sourcesBacterial growth, virulenceMay identify novel scaffolds

How does the function of lspA relate to Y. pestis immune evasion mechanisms?

LspA plays an integral role in Y. pestis immune evasion through processing of several crucial lipoproteins:

  • Ail processing: LspA is required for proper maturation of Ail, a key lipoprotein that contributes significantly to serum resistance. Y. pestis strains deficient in Ail are extremely sensitive to complement, indicating its critical role in evading this innate immune defense mechanism .

  • Complement resistance: Y. pestis is resistant to complement-mediated lysis at both 26°C and 37°C, unlike enteropathogenic yersiniae. This resistance depends partly on properly processed lipoproteins, suggesting lspA's importance in maintaining this immune evasion mechanism .

  • LPS structure modifications: LspA's indirect effects on LPS structure influence how Y. pestis interacts with host immune components. Temperature-dependent variations in LPS structure, potentially influenced by lspA-processed proteins, affect recognition by host pattern recognition receptors .

  • Innate immunity modulation: Properly processed lipoproteins may help Y. pestis evade both insect-vector and mammal-host innate immunity factors, facilitating survival in both environments .

What experimental approaches are most effective for studying lspA function in Y. pestis?

Recommended experimental approaches:

ApproachMethodologyApplicationsLimitations
Gene knockout/knockdownCRISPR-Cas9 or transposon mutagenesisPhenotypic analysis of lspA-deficient strainsPotential lethality if essential
Site-directed mutagenesisPCR-based mutagenesis of catalytic residuesStructure-function analysisMay not fully eliminate function
ProteomicsMass spectrometry analysis of processed vs. unprocessed lipoproteinsIdentifying lspA substratesTechnical challenges in membrane protein analysis
Animal infection modelsIn vivo studies with wild-type vs. lspA mutantsVirulence and immune response assessmentEthical considerations, BSL-3 requirements
Biochemical assaysIn vitro activity assays with purified lspAEnzyme kinetics, inhibitor testingMay not reflect in vivo activity

For all experimental approaches studying Y. pestis lspA, appropriate biosafety measures must be implemented as Y. pestis is a Tier 1 Select Agent requiring BSL-3 containment. Using attenuated strains like KIM10(pCD1Ap) (Pgm−, pPCP1−) allows for safer handling while still providing valuable insights into lspA function .

How can recombinant lspA be used in vaccine development against Y. pestis?

Recombinant Y. pestis lspA has potential applications in vaccine development through several strategies:

  • Subunit vaccine component: Purified recombinant lspA could be included in subunit vaccine formulations, potentially eliciting antibodies that interfere with lipoprotein processing.

  • Live attenuated vaccine engineering: Strains with modified lspA activity could be developed as live attenuated vaccines with reduced virulence while maintaining immunogenicity. This approach could build upon existing attenuated strains like the YPS19(pCD1Ap) strain, which already shows promising protection against bubonic and pneumonic plague .

  • Adjuvant development: Understanding how lspA-processed lipoproteins and LPS interact with the immune system could inform adjuvant design for plague vaccines.

Immunization route considerations:

Intramuscular (i.m.) administration with attenuated Y. pestis strains has been shown to afford significant protection against both bubonic and pneumonic plague compared to subcutaneous (s.c.) administration. The i.m. route induces balanced Th1 and Th2 responses, while s.c. administration stimulates Th2-biased responses, suggesting that route optimization is critical for effective immunity .

What are the temperature-dependent variations in lspA expression and how do they impact Y. pestis virulence?

Y. pestis demonstrates remarkable temperature-dependent variations in virulence factor expression as it transitions between flea vectors (26°C) and mammalian hosts (37°C). LspA function appears to be integrated within this temperature-responsive system:

  • Expression patterns: While specific lspA expression data is limited, Y. pestis shows temperature-dependent regulation of multiple membrane components, including LPS structural modifications.

  • Lipid A processing: Y. pestis modifies its lipid A structure in response to temperature, with tetra-acylated forms predominating at 37°C and hexa-acylated forms at lower temperatures. LspA-processed proteins may be involved in this temperature-dependent lipid A remodeling .

  • Immune recognition consequences: The temperature-dependent LPS modifications affect recognition by host Toll-like receptors, with the 37°C form (found in mammals) generally being less stimulatory to the immune system, facilitating immune evasion .

  • Vaccine implications: Understanding the temperature-dependence of lspA function could inform the development of temperature-controlled expression systems for attenuated vaccine strains. The YPS19(pCD1Ap) strain, which synthesizes mainly hexa-acylated lipid A (resembling the lower-temperature form), shows reduced virulence while maintaining immunogenicity .

How does Y. pestis bv. Antiqua lspA compare to lspA in other bacterial pathogens?

Y. pestis bv. Antiqua lspA shares significant homology with lspA from other bacterial species, but with important distinctions:

  • Within Yersinia genus: There is 98-100% homology in proteins participating in key cellular processes (including lspA) within the Yersinia genus, reflecting their close evolutionary relationships .

  • Compared to other Enterobacteriaceae: Y. pestis lspA shows moderate to high homology with lspA from other Enterobacteriaceae, but with specific sequence differences that might reflect adaptation to the plague bacterium's unique lifestyle.

  • Functional conservation: The catalytic mechanism of lspA is highly conserved across bacterial species, reflecting the essential nature of lipoprotein processing.

  • Substrate specificity variations: Different bacterial species may show variations in lspA substrate specificity and regulation, potentially contributing to pathogen-specific virulence mechanisms.

What are the key methodological considerations for performing structure-function studies on Y. pestis lspA?

Structure-function studies of Y. pestis lspA require careful methodological planning:

  • Structural analysis approaches:

    • X-ray crystallography: Challenging due to membrane protein nature; requires detergent optimization

    • Cryo-EM: Increasingly valuable for membrane protein structure determination

    • NMR spectroscopy: Useful for dynamic regions and ligand interactions

    • Computational modeling: Based on homology with known structures

  • Mutagenesis strategy:

    • Generate a panel of point mutations in catalytic residues and substrate-binding regions

    • Create chimeric proteins with lspA regions from other species to identify determinants of specificity

    • Express mutant proteins in lspA-deficient backgrounds to assess functional complementation

  • Activity assays:

    • Develop fluorogenic peptide substrates based on native Y. pestis lipoprotein signal sequences

    • Establish cell-based assays measuring processing of reporter lipoproteins

    • Compare activity across temperature ranges relevant to Y. pestis lifecycle (20-37°C)

  • Biosafety considerations:

    • Perform structure-function work in attenuated Y. pestis strains lacking key virulence factors

    • Consider using heterologous expression systems for initial characterization

How can recombinant Y. pestis lspA be utilized to identify novel antimicrobial targets?

Recombinant Y. pestis lspA offers multiple avenues for antimicrobial target discovery:

  • High-throughput screening platform: Purified recombinant lspA can serve as a target for screening chemical libraries to identify inhibitors with potential antimicrobial activity.

  • Structure-guided inhibitor design: Structural insights from recombinant lspA can guide the rational design of inhibitors targeting specific catalytic or binding sites.

  • Substrate profiling: Using recombinant lspA to identify its complete substrate profile in Y. pestis could reveal additional lipoproteins that might serve as antimicrobial targets.

  • Cross-species inhibition potential: Comparative studies between Y. pestis lspA and homologs from other pathogens could identify broadly acting inhibitors with potential against multiple bacterial species.

  • Combination therapy exploration: Identifying synergistic interactions between lspA inhibitors and conventional antibiotics could lead to more effective treatment strategies, particularly important given concerns about antimicrobial resistance.

What strategies can optimize expression and stabilization of recombinant Y. pestis lspA for structural studies?

Optimizing expression and stabilization of recombinant Y. pestis lspA requires addressing several key challenges:

  • Expression optimization:

    • Codon optimization for the expression host

    • Testing multiple fusion tags (His, MBP, SUMO) to identify optimal solubility and expression

    • Screening expression conditions (temperature, inducer concentration, duration)

    • Evaluating specialized expression systems for membrane proteins (C43(DE3), Lemo21(DE3))

  • Membrane protein stabilization:

    • Systematic detergent screening (DDM, LMNG, GDN) for optimal extraction and stability

    • Incorporation into nanodiscs or lipid cubic phase for structural studies

    • Addition of specific lipids that might enhance stability

    • Use of thermostabilizing mutations based on computational prediction

  • Storage and handling:

    • Store in Tris-based buffer with 50% glycerol at -20°C

    • Avoid repeated freeze-thaw cycles

    • Consider flash-freezing aliquots in liquid nitrogen

    • Test stabilizing additives (glycerol, specific lipids, cholesterol hemisuccinate)

  • Quality assessment:

    • Size-exclusion chromatography to verify monodispersity

    • Thermal stability assays (differential scanning fluorimetry)

    • Activity assays to confirm functional integrity

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.