Recombinant Yersinia pestis bv. Antiqua Na (+)-translocating NADH-quinone reductase subunit E (nqrE)

Shipped with Ice Packs
In Stock

Description

Introduction to Na+-NQR and NqrE

Na+-translocating NADH-quinone reductase (Na+-NQR) is a membrane-bound enzyme complex responsible for electron transfer from NADH to quinone, coupled with Na+ transport across bacterial membranes . In Yersinia pestis bv. Antiqua, the NqrE subunit (encoded by the nqrE gene) forms part of this six-subunit complex (NqrA-F), contributing to its structural integrity and catalytic activity . Recombinant NqrE is engineered for biochemical studies, featuring a His-tagged construct expressed in Escherichia coli for purification and functional analysis .

Biogenesis and Maturation Factors

Na+-NQR requires two maturation factors for functional assembly:

  1. ApbE: Attaches flavin mononucleotide (FMN) to the complex .

  2. NqrM (DUF539): Facilitates Fe-S cluster insertion into NqrD-NqrE .

Maturation FactorRole in Na+-NQR AssemblyImpact of Mutation
ApbECovalent FMN attachmentLoss of quinone reductase activity
NqrMFe delivery to NqrD-NqrEDisrupted subunit assembly; no enzyme activity

Mutating Cys33 in NqrM completely abolished Na+-NQR activity, underscoring its role in Fe coordination .

Recombinant Expression and Purification

  • Expression system: E. coli (strain unspecified) with a pBAD plasmid under arabinose induction .

  • Activity metrics:

    • Na+-stimulated dNADH oxidase activity reached 65 ± 8 nmol·min⁻¹·mg⁻¹ in membrane vesicles when co-expressed with apbE and nqrM .

    • Absence of NqrM reduced activity to <1 nmol·min⁻¹·mg⁻¹ .

Table 1: Functional Activity of Recombinant Na+-NQR in E. coli

ConstructNa+-Stimulated dNADH Oxidase (nmol·min⁻¹·mg⁻¹)dNADH:Menadione Oxidoreductase (nmol·min⁻¹·mg⁻¹)
pNQ_AE_NqrM (full set)65 ± 8310 ± 60
pNQ_AE (no NqrM)3 ± 1260 ± 40
pNQ (no ApbE/NqrM)<1240 ± 70
  • Key observation: Functional Na+-NQR production in E. coli is strictly dependent on co-expression of nqrM and apbE .

Implications for Pathogenicity and Drug Development

  • Physiological role: Na+-NQR enhances bacterial vitality under low-oxygen conditions, promoting survival in hosts like fleas and mammals .

  • Drug target potential: Disrupting NqrM or ApbE could inhibit Na+-NQR assembly, offering a strategy to combat Y. pestis and other pathogens .

  • Oxidative stress link: Na+-NQR contributes to superoxide production in Vibrio cholerae, suggesting a role in bacterial stress response and virulence .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your requests as best as possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to concentrate the contents. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
nqrE; YPN_0859; YP516_0928; Na(+-translocating NADH-quinone reductase subunit E; Na(+-NQR subunit E; Na(+-translocating NQR subunit E; NQR complex subunit E; NQR-1 subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-198
Protein Length
full length protein
Species
Yersinia pestis bv. Antiqua (strain Nepal516)
Target Names
nqrE
Target Protein Sequence
MEHYISLLVRAVFVENMALAFFLGMCTFLAVSKKVSTAFGLGIAVTVVLGISVPANNLVY NLVLRDGALVEGVDLSFLNFITFIGVIAAIVQVLEMILDRYFPALYNALGIFLPLITVNC AIFGGVSFMAQRDYNFPESIVYGFGSGMGWMLAIVALAGIREKMKYANVPAGLQGLGITF ISTGLMALGFMSFAGVNL
Uniprot No.

Target Background

Function
The NQR complex catalyzes the reduction of ubiquinone-1 to ubiquinol through two consecutive reactions, coupled with the transport of Na(+) ions from the cytoplasm to the periplasm. NqrA to NqrE are likely involved in the second step, the conversion of ubisemiquinone to ubiquinol.
Database Links

KEGG: ypn:YPN_0859

Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Yersinia pestis and why is its Na(+)-translocating NADH-quinone reductase significant?

Yersinia pestis is the bacterium responsible for plague, a severe disease found in rodents and their fleas across various global regions. The bacterium contains specific virulence factors and metabolic systems that contribute to its pathogenicity . The Na(+)-translocating NADH-quinone reductase (Na+-NQR) is particularly significant because it represents a specialized respiratory enzyme complex that couples NADH oxidation to sodium ion translocation across the bacterial membrane. This mechanism generates an electrochemical gradient essential for various cellular processes, including energy production . In bacterial pathogens like Y. pestis, this respiratory chain component could serve as a potential antibiotic target since it differs structurally from the mitochondrial counterparts in human cells .

What are the structural characteristics of the nqrE subunit in Y. pestis bv. Antiqua?

The nqrE subunit of Na(+)-translocating NADH-quinone reductase in Yersinia pestis bv. Antiqua is a 198-amino acid membrane protein. According to sequence analysis, the protein exhibits a predominantly hydrophobic character, with multiple transmembrane segments that anchor it within the bacterial membrane . The amino acid sequence (MEHYISLLVRAVFVENMALAFFLGMCTFLAVSKKVSTAFGLGIAVTVVLGISVPANNLVYNLVLRDGALVEGVDLSFLNFITFIGVIAAIVQVLEMILDRYFPALYNALGIFLPLITVNCAIFGGVSFMAQRDYNFPESIVYGFGSGMGWMLAIVALAGIREKMKYANVPAGLQGLGITFISTGLMALGFMSFAGVNL) indicates a protein structure adapted to the membrane environment, consistent with its role in the respiratory chain complex . The recombinant version typically includes an N-terminal His-tag to facilitate purification and experimental manipulation .

How does the Na+-NQR complex function in bacterial respiratory chains?

The Na+-NQR complex in bacterial respiratory chains functions through a sophisticated electron transfer mechanism that couples NADH oxidation to sodium ion translocation. Based on structural and functional studies of similar complexes, the electron transport pathway involves a unique set of redox cofactors including flavin adenine dinucleotide (FAD), covalently bound flavin mononucleotides (FMNs), riboflavin, and iron-sulfur centers . The process begins with electron acceptance from NADH, followed by sequential electron transfer through these cofactors, ultimately reducing ubiquinone. This electron transfer induces conformational changes in the protein complex, which drives the translocation of sodium ions (Na+) across the membrane against their concentration gradient . The nqrE subunit likely participates in forming the transmembrane channel through which Na+ ions are transported, contributing to the generation of the electrochemical gradient that powers various cellular processes.

What are the optimal conditions for expressing recombinant nqrE protein in E. coli systems?

For optimal expression of recombinant nqrE protein in E. coli systems, researchers should consider several critical parameters. Based on standard protocols for membrane proteins, expression should be conducted in specialized E. coli strains such as BL21(DE3), C41(DE3), or C43(DE3), which are engineered to tolerate membrane protein overexpression . The expression vector should contain a strong, inducible promoter (typically T7) and include an N-terminal His-tag for purification purposes.

The following experimental conditions typically yield optimal results:

ParameterRecommended ConditionRationale
Growth temperature18-25°CLower temperatures reduce protein aggregation and inclusion body formation
Induction OD6000.6-0.8Optimal cell density for induction
Inducer concentration0.1-0.5 mM IPTGModerate induction prevents toxicity
Post-induction time12-16 hoursExtended expression period at lower temperature
Media compositionTB or 2xYT with glucoseRich media supports membrane protein folding
Supplements5-10 μM FMN/FADAssists cofactor incorporation for functional protein

It's essential to monitor expression using small-scale trials before proceeding to large-scale production, as membrane proteins like nqrE often require strain-specific optimization .

What purification strategy provides the highest yield and purity of functional nqrE protein?

A multi-step purification strategy is required to obtain high-yield, high-purity functional nqrE protein. Based on established membrane protein purification protocols, the following approach is recommended:

  • Membrane Isolation: After cell lysis by sonication or high-pressure homogenization, collect membrane fractions through differential centrifugation (typically 100,000 × g for 1 hour).

  • Detergent Solubilization: Solubilize membranes using a mild detergent such as n-dodecyl-β-D-maltoside (DDM) at 1-2% concentration in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, and 10% glycerol.

  • Immobilized Metal Affinity Chromatography (IMAC): Apply the solubilized protein to a Ni-NTA column, wash with 20-50 mM imidazole, and elute with 250-300 mM imidazole.

  • Size Exclusion Chromatography (SEC): Further purify the IMAC-eluted protein using SEC to remove aggregates and obtain monodisperse protein.

Purification yield and purity assessment:

Purification StepTypical Yield (%)Typical Purity (%)Assessment Method
Membrane isolation80-9010-20SDS-PAGE/Western blot
Detergent solubilization60-7030-40SDS-PAGE/Western blot
IMAC40-5080-90SDS-PAGE/Western blot
SEC30-40>95SDS-PAGE/Western blot

The final purified protein should be stored in a stabilizing buffer containing 0.05% DDM, 150 mM NaCl, 20 mM Tris-HCl pH 7.5, and 10% glycerol, preferably as aliquots at -80°C to prevent freeze-thaw cycles .

How can researchers validate the functional integrity of purified recombinant nqrE?

Validating the functional integrity of purified recombinant nqrE requires multiple complementary approaches that assess both structural integrity and biochemical activity. The following methodological strategy is recommended:

  • Spectroscopic Analysis: UV-visible spectroscopy to detect characteristic absorbance patterns of bound cofactors (if applicable). Compare spectra between 300-600 nm with published reference data.

  • Circular Dichroism (CD): Evaluate secondary structure integrity, particularly important for transmembrane proteins with significant α-helical content.

  • NADH Oxidation Assay: Although isolated nqrE may not catalyze NADH oxidation alone, it should enhance activity when reconstituted with other subunits of the Na+-NQR complex. Monitor NADH oxidation by measuring absorbance decrease at 340 nm.

  • Sodium Transport Assay: Reconstitute purified protein into liposomes containing a sodium-sensitive fluorescent dye (e.g., SBFI) and measure sodium transport upon addition of NADH and appropriate electron acceptors.

  • Thermal Shift Assay: Assess protein stability using differential scanning fluorimetry with SYPRO Orange dye. Functional protein should display a cooperative unfolding transition.

A functional validation matrix for quality control:

Validation ParameterAcceptance CriteriaTroubleshooting if Failed
Purity by SDS-PAGE>90%Optimize purification protocol
Secondary structure by CDα-helical predominanceCheck detergent and buffer conditions
Thermal stabilityTm ≥ 40°COptimize buffer composition
Reconstituted NADH oxidation≥30% of reference activityVerify cofactor content and reconstitution efficiency
Na+ transportDetectable fluorescence changeCheck membrane reconstitution and integrity

These combined approaches provide comprehensive validation of the structural and functional integrity of the purified recombinant nqrE protein .

How can researchers investigate the role of nqrE in Na+ translocation mechanisms?

Investigating the role of nqrE in Na+ translocation mechanisms requires sophisticated experimental approaches that integrate structural biology, biochemistry, and biophysics. Researchers should consider the following methodological framework:

  • Site-Directed Mutagenesis: Systematically introduce mutations in putative Na+-binding residues (typically negatively charged amino acids like Asp and Glu) within transmembrane regions of nqrE. Based on the amino acid sequence provided, residues embedded in hydrophobic transmembrane regions that contain charged or polar groups would be prime candidates for mutation .

  • Reconstitution Studies: Reconstitute wild-type and mutant nqrE proteins into proteoliposomes with purified partner subunits of the Na+-NQR complex. Measure Na+ translocation using:

    • Radioactive 22Na+ uptake assays

    • Sodium-sensitive fluorescent dyes (e.g., SBFI, CoroNa Green)

    • Potential-sensitive dyes to monitor membrane potential changes

  • Cryo-EM Analysis: Pursue high-resolution structural studies to visualize conformational changes in nqrE during the catalytic cycle. Reference studies on the V. cholerae Na+-NQR suggest that large conformational changes couple electron transfer to ion translocation .

  • Cross-linking Experiments: Use chemical cross-linkers of varying lengths to identify dynamic protein-protein interactions between nqrE and other Na+-NQR subunits during catalysis.

  • MD Simulations: Perform molecular dynamics simulations to model Na+ movement through putative channels in nqrE and identify key residues involved in cation coordination.

The correlation between electron transfer and Na+ translocation can be experimentally demonstrated through simultaneous measurement of both processes in reconstituted systems. This approach would reveal how changes in the redox state of the unique cofactor set in Na+-NQR (including the [2Fe-2S] cluster mentioned in related studies) orchestrate the conformational changes necessary for Na+ translocation .

What structural features distinguish nqrE from Yersinia pestis compared to homologous proteins in other bacterial pathogens?

The structural features distinguishing nqrE from Yersinia pestis compared to homologous proteins in other bacterial pathogens can be systematically analyzed through comparative sequence analysis, structural predictions, and experimental validation. Based on the available information, several distinctive aspects emerge:

Sequence Analysis Comparison:

SpeciesSequence Identity to Y. pestis nqrE (%)Key Differential Features
Vibrio cholerae~60-70 (estimated)Differences in putative Na+-binding residues
Pseudomonas aeruginosa~50-60 (estimated)Variant transmembrane topology
Klebsiella pneumoniae~65-75 (estimated)Similar core structure with variations in loop regions
Escherichia coliNot applicableE. coli lacks Na+-NQR, using NDH-1 instead

Distinguishing Structural Features:

  • Transmembrane Topology: The Y. pestis nqrE contains multiple transmembrane helices that likely form part of the Na+ translocation pathway. The specific arrangement of these helices may differ from homologs in other pathogens, potentially affecting substrate specificity or regulatory properties.

  • Na+ Coordination Sites: The amino acid residues involved in Na+ coordination within the transmembrane domains are likely conserved among Na+-NQR-containing bacteria but may show subtle variations that affect ion selectivity or transport kinetics.

  • Interfacial Regions: The regions of nqrE that interface with other subunits (particularly NqrB and NqrD) may contain species-specific adaptations that optimize complex assembly and stability under the particular physiological conditions encountered by Y. pestis.

  • Post-translational Modifications: The potential for species-specific post-translational modifications could further differentiate the Y. pestis nqrE from its homologs.

  • Redox Partner Interactions: The regions of nqrE that interact with electron transfer partners may show adaptations specific to the Y. pestis respiratory chain components.

These distinguishing features could be experimentally validated through heterologous complementation studies, where nqrE from Y. pestis is expressed in other bacterial species with Na+-NQR knockouts to assess functional interchangeability .

How might nqrE function in the context of Y. pestis pathogenesis and host adaptation?

The function of nqrE in Y. pestis pathogenesis and host adaptation represents a complex intersection of bacterial bioenergetics, stress response, and virulence regulation. Several research-based hypotheses and experimental approaches can illuminate this relationship:

Pathogenesis Relationships and Mechanisms:

  • Energy Metabolism During Host Transition: Y. pestis transitions between distinct host environments (flea vector at ~25°C to mammalian host at 37°C). The Na+-NQR complex containing nqrE may be differentially regulated during this transition to optimize energy production under varying temperature and pH conditions. The Na+ gradient generated by this complex could be particularly important during adaptation to the mammalian environment, where competition for resources with host cells is intense .

  • Resistance to Immune-Generated Stress: During infection, Y. pestis faces oxidative stress from host immune responses. The Na+-NQR complex may contribute to maintaining membrane potential and energy production under these stress conditions, with nqrE playing a critical role in the ion translocation necessary for this function.

  • Biofilm Formation: Y. pestis forms biofilms in the flea vector. The energy provided by Na+-NQR activity could support biofilm matrix production, with nqrE function potentially modulated during this process.

Experimental Approaches to Investigate These Hypotheses:

Research QuestionMethodological ApproachExpected Outcome
Is nqrE expression regulated during temperature shift?qRT-PCR and western blot analysis of nqrE expression at 25°C vs. 37°CIdentification of temperature-dependent regulation patterns
Does nqrE contribute to virulence?Construct nqrE deletion mutant and assess virulence in animal modelsDetermination of virulence attenuation in mutant strains
Is nqrE required for resistance to oxidative stress?Challenge wild-type and nqrE mutant strains with hydrogen peroxide and measure survivalQuantification of differential survival under oxidative stress
Does nqrE function affect biofilm formation?Compare biofilm formation between wild-type and nqrE mutant strainsAssessment of biofilm quantity and quality differences
Is nqrE involved in antibiotic resistance?Determine MICs of various antibiotics for wild-type and nqrE mutant strainsIdentification of any differential antibiotic susceptibility

The relationship between Na+-NQR function and antibiotic resistance is particularly noteworthy, as NADH:quinone oxidoreductases in bacterial pathogens have been identified as promising targets for new antibiotics. Understanding how nqrE contributes to this process could inform drug development strategies against Y. pestis and other pathogens containing Na+-NQR systems .

What experimental controls are essential when working with recombinant Y. pestis nqrE protein?

When designing experiments with recombinant Y. pestis nqrE protein, implementing appropriate controls is critical for reliable and interpretable results. The following control framework addresses multiple experimental dimensions:

Positive and Negative Controls for Expression and Purification:

  • Positive Control Protein: A well-characterized membrane protein (e.g., bacterial rhodopsin) expressed and purified under identical conditions to validate the expression system and purification protocol.

  • Empty Vector Control: E. coli containing the expression vector without the nqrE gene to identify background proteins that co-purify with the His-tag purification system.

  • Heat-Denatured nqrE: Purified nqrE protein subjected to thermal denaturation (95°C for 10 minutes) to serve as a negative control for functional assays.

Biochemical Assay Controls:

Assay TypeEssential ControlsPurpose
Na+ TransportProteoliposomes without reconstituted proteinEstablish baseline leakage and non-specific transport
Proteoliposomes with irrelevant membrane proteinControl for general membrane perturbation effects
Addition of specific Na+-NQR inhibitors (e.g., HQNO)Confirm specificity of measured activity
Structural AnalysisDetergent-only samplesAccount for detergent contribution to spectroscopic measurements
Known α-helical protein standardCalibrate CD spectroscopy measurements
Protein-Protein InteractionGST-only or MBP-only tagsControl for non-specific binding in pull-down assays
Scrambled peptide controlsValidate specificity in peptide-based interaction studies

Biosafety Controls:

When working with proteins derived from Y. pestis, additional safety controls are necessary. While recombinant nqrE protein alone does not present the pathogenic risks associated with live Y. pestis, standard biosafety practices (minimum BSL-2) should be maintained. All experiments should include sterility controls to ensure no biological contamination is present in purified protein preparations .

Statistical Validation:

All experiments should include sufficient biological replicates (minimum n=3) and technical replicates to enable robust statistical analysis. Power analysis should be performed during experimental design to determine appropriate sample sizes for detecting anticipated effect sizes with statistical confidence .

How can researchers troubleshoot issues with nqrE protein stability and activity?

Troubleshooting nqrE protein stability and activity issues requires a systematic approach that addresses multiple potential failure points. The following comprehensive troubleshooting guide identifies common problems and provides evidence-based solutions:

Protein Stability Issues:

ProblemPotential CausesDiagnostic ApproachSolution Strategies
Precipitation during purificationDetergent concentration too lowVisible turbidity, protein loss during centrifugationIncrease detergent concentration to 2× CMC; test alternative detergents (DDM, LMNG, DMNG)
Buffer incompatibilitypH-dependent precipitationOptimize buffer composition; screen pH range 6.5-8.5
Removal of stabilizing lipidsIncreased precipitation after IMACAdd 0.1-0.2 mg/ml E. coli lipid extract to buffers
Degradation during storageProtease contaminationAppearance of lower MW bands on SDS-PAGEAdd protease inhibitor cocktail; purify to higher homogeneity
Freeze-thaw damageProgressive activity loss with freeze-thaw cyclesStore in small aliquots; add 10% glycerol or trehalose
AggregationConcentration too highIncreasing turbidity or viscosity during concentrationKeep below critical concentration (typically <5 mg/ml)
Cofactor lossLoss of characteristic spectral featuresSupplement purification buffers with relevant cofactors

Activity Issues:

ProblemDiagnostic ApproachSolution Strategies
Low or absent Na+ transportMeasure Na+ transport using multiple methodologies (fluorescence, radioactive)Verify membrane reconstitution efficiency; optimize protein:lipid ratio; ensure complete complex reconstitution
Poor complex assemblyBlue native PAGE to assess complex formationCo-express multiple subunits; sequential addition during reconstitution
Incorrect foldingCD spectroscopy to assess secondary structureOptimize detergent and lipid environment; try gentle refolding protocols
Loss of cofactorsUV-visible spectroscopy to detect cofactor signaturesSupplement purification buffers with cofactors; reduce exposure to light and oxidizing agents

Advanced Troubleshooting Decision Tree:

  • Is the protein pure? → If no, optimize purification to remove contaminants that may interfere with activity.

  • Is the protein correctly folded? → If no, adjust detergent type/concentration or add specific lipids to stabilize native structure.

  • Are all cofactors present? → If no, supplement with required cofactors or co-factors.

  • Is the protein in an appropriate membrane environment? → If no, optimize lipid composition for reconstitution.

  • Are partner proteins required for activity? → If yes, ensure proper assembly of the complete Na+-NQR complex.

This methodical approach allows researchers to systematically identify and address factors affecting nqrE stability and activity, improving experimental outcomes and data reliability .

What considerations are important when designing inhibitor screening assays targeting the Na+-NQR complex containing nqrE?

Designing effective inhibitor screening assays targeting the Na+-NQR complex containing nqrE requires careful consideration of multiple factors to ensure reliability, specificity, and translational relevance. The following framework addresses key considerations for developing robust screening platforms:

Assay Platform Selection and Validation:

Assay TypeKey ConsiderationsAdvantagesLimitations
NADH Oxidation AssayMonitor NADH oxidation at 340 nm in reconstituted complexDirect measure of enzyme activity; simple spectrophotometric readoutDoes not directly measure Na+ transport; potential interference from compound absorbance
Na+ Transport AssaysUse fluorescent Na+ indicators in proteoliposomesDirectly measures the physiological function of interestComplex setup; higher variability; time-consuming
Membrane Potential AssaysPotential-sensitive dyes (e.g., DiSC3)Measures functional consequence of Na+ transportIndirect measure; potential false positives
Thermal Shift AssaysDifferential scanning fluorimetry with purified complexHigh-throughput; identifies direct bindersMay identify non-inhibitory binders; requires purified stable complex
Surface Plasmon ResonanceDirect binding to immobilized complexProvides binding kinetics; no activity requiredRequires stable immobilized complex; does not confirm inhibition

Critical Parameters for Assay Development:

  • Assay Miniaturization: Optimize reaction volumes and protein concentrations to minimize reagent consumption while maintaining signal-to-noise ratio. For 384-well formats, 25-50 μl volumes are typically suitable.

  • Signal Window Optimization: Ensure Z' factor >0.5 for high-throughput applications by optimizing substrate concentrations, enzyme amounts, and detection parameters.

  • Counter-screens for Specificity:

    • Parallel screening against human Complex I (mitochondrial NADH:ubiquinone oxidoreductase)

    • Screening against other bacterial respiratory enzymes (e.g., NDH-2)

    • Detergent interference assays to identify false positives due to protein denaturation

  • Physiological Relevance:

    • Secondary assays in bacterial growth systems (Y. pestis or surrogate organisms)

    • Confirmation of target engagement in live bacteria using cellular thermal shift assays

    • Correlation of enzyme inhibition with antimicrobial activity

Inhibitor Characterization Matrix:

For promising hits, a comprehensive characterization should include:

ParameterMethodologySignificance
IC50 valueDose-response curves in primary assayPotency assessment
Mechanism of inhibitionKinetic studies with varying substrate concentrationsCompetitive vs. non-competitive classification
Binding site identificationResistance mutation analysis; HDX-MS studiesTarget validation and structure-activity relationships
Specificity profilePanel testing against related enzymesSelectivity assessment
Bactericidal activityMIC/MBC determination against Y. pestisTranslation to antimicrobial potential
CytotoxicityMammalian cell viability assaysSafety assessment

When designing these assays, it's important to consider that the Na+-NQR complex in bacterial pathogens represents a promising antibiotic target due to its absence in human cells. This offers the potential for selective inhibition without affecting host cell metabolism, which could lead to new antibiotics against Y. pestis and other pathogens containing this complex .

What emerging technologies could advance our understanding of nqrE structure-function relationships?

Several cutting-edge technologies are poised to revolutionize our understanding of nqrE structure-function relationships, offering unprecedented insights into its role within the Na+-NQR complex. The following emerging approaches represent significant opportunities for researchers in this field:

Advanced Structural Biology Approaches:

  • Cryo-Electron Tomography (cryo-ET): This technology can visualize the Na+-NQR complex containing nqrE in its native membrane environment, revealing physiologically relevant conformational states and interactions with other membrane components. Combined with subtomogram averaging, cryo-ET could capture multiple functional states of the complex during the catalytic cycle.

  • Integrative Structural Biology: Combining multiple structural determination methods (X-ray crystallography, cryo-EM, NMR, and computational modeling) can overcome limitations of individual techniques, particularly for dynamic membrane protein complexes like Na+-NQR.

  • Time-Resolved Structural Methods: Techniques such as time-resolved cryo-EM and X-ray free-electron laser (XFEL) crystallography can capture transient structural states during Na+ translocation, providing dynamic insights into the mechanism.

Advanced Functional Characterization Approaches:

TechnologyApplication to nqrE ResearchPotential Insights
Single-Molecule FRETMonitoring real-time conformational changes in labeled nqrEDirect observation of structural dynamics during catalysis
Nanodiscs TechnologyReconstitution of Na+-NQR in lipid nanodiscsStudy of complex in defined lipid environment with controlled orientation
Microfluidic SystemsHigh-throughput screening of nqrE variants or conditionsRapid optimization of functional parameters
Electrophysiology (patch-clamp)Direct measurement of Na+ currentsPrecise quantification of ion transport kinetics
In-cell NMRStructural analysis in live bacterial cellsNative conformational states and dynamics

Cutting-Edge Genetic and Molecular Tools:

These emerging technologies, particularly when used in combination, promise to resolve longstanding questions about how electron transfer through the unique cofactor set in Na+-NQR is coupled to Na+ translocation through nqrE and partner subunits. The mechanistic insights gained could inform the development of novel antibiotics targeting this essential bacterial system .

How might comparative studies between Y. pestis nqrE and homologs inform therapeutic development?

Comparative studies between Y. pestis nqrE and its homologs in other bacterial pathogens offer significant potential for informing therapeutic development strategies. These comparative approaches can identify both conserved elements critical for function and unique features that might enable species-specific targeting. The following framework outlines key research directions and their potential implications:

Evolutionary Conservation Analysis:

A systematic comparative analysis of nqrE across multiple bacterial species can identify:

  • Core Functional Domains: Highly conserved regions likely represent essential functional elements required for Na+ translocation or complex assembly. These domains offer potential broad-spectrum therapeutic targets.

  • Species-Specific Elements: Regions unique to Y. pestis nqrE may provide opportunities for selective targeting of this pathogen without affecting commensal bacteria.

Comparative Structure-Function Analysis Matrix:

Comparative ElementResearch ApproachTherapeutic Implications
Conserved Na+-binding sitesSite-directed mutagenesis with functional validation across speciesTarget for broad-spectrum inhibitors
Species-specific transmembrane organizationComprehensive topology mapping across homologsPotential for species-selective compound design
Differential cofactor requirementsBiochemical characterization of reconstituted complexesExploit metabolic differences for targeted inhibition
Interface regions with partner subunitsCross-linking and interaction analyses across speciesDisrupt complex assembly in species-specific manner
Differential response to environmental factorsCompare activity under various pH, temperature, and ionic conditionsIdentify condition-specific vulnerabilities

Homology Modeling and Virtual Screening:

Using structural data from better-characterized Na+-NQR complexes (such as from Vibrio cholerae) to generate homology models of Y. pestis Na+-NQR enables:

  • In silico screening of compound libraries against predicted binding pockets

  • Rational design of inhibitors targeting Y. pestis-specific structural features

  • Prediction of resistance mutations and pre-emptive design of alternative inhibitors

Therapeutic Development Strategies:

Based on comparative analyses, several therapeutic approaches emerge:

  • Broad-Spectrum Na+-NQR Inhibitors: Targeting highly conserved functional regions common to nqrE across multiple pathogens could yield antibiotics effective against Y. pestis, V. cholerae, and multidrug-resistant Pseudomonas and Klebsiella strains.

  • Y. pestis-Specific Inhibitors: Compounds designed to interact with unique structural features of Y. pestis nqrE could provide highly selective anti-plague agents with minimal impact on commensal microbiota.

  • Combination Therapies: Inhibitors targeting different components of the Na+-NQR complex (e.g., both nqrE and nqrB) could reduce the likelihood of resistance development through mutations in any single subunit.

  • Allosteric Modulators: Rather than targeting the active site, compounds that bind to species-specific allosteric sites could modulate nqrE function in more subtle ways, potentially reducing selective pressure for resistance.

This comparative approach not only advances fundamental understanding of nqrE function across bacterial species but also provides practical guidance for therapeutic development against Y. pestis and other pathogens containing the Na+-NQR system .

What are the potential applications of nqrE research in biotechnology beyond therapeutic development?

The research on Na+-translocating NADH-quinone reductase subunit E (nqrE) from Y. pestis has implications that extend well beyond therapeutic development, offering diverse applications in biotechnology. These applications leverage the unique properties of this membrane protein complex to address challenges in bioenergy, biosensing, and bioprocessing:

Bioenergy Applications:

  • Engineered Microbial Fuel Cells: The Na+-NQR complex containing nqrE could be incorporated into engineered bacterial strains to enhance electron transfer to electrodes in microbial fuel cells. The natural coupling of NADH oxidation to ion translocation provides an efficient mechanism for converting metabolic energy into electrical current.

  • Biohydrogen Production: Modified Na+-NQR complexes could potentially be engineered to couple NADH oxidation to proton reduction, generating hydrogen gas as a clean energy carrier.

  • ATP Regeneration Systems: In vitro systems utilizing the Na+ gradient generated by Na+-NQR could be coupled to ATP synthase to regenerate ATP for biocatalytic processes, creating more sustainable enzymatic production systems.

Biosensing Technologies:

ApplicationTechnical ApproachPotential Advantages
Na+ BiosensorsReconstituted nqrE in liposomes with fluorescent readoutHighly specific detection of Na+ in complex samples
Redox State MonitorsnqrE-based detection systems for cellular NADH/NAD+ ratioReal-time monitoring of metabolic state
Environmental Toxin DetectionModified nqrE sensitive to specific environmental pollutantsRapid field-deployable detection systems

Bioprocessing and Synthetic Biology Platforms:

  • Enhanced Protein Expression Systems: Engineered bacterial strains with optimized Na+-NQR activity could provide improved energetics for recombinant protein production, particularly for high-demand processes.

  • Membrane Protein Production Platform: The insights gained from successfully expressing and purifying nqrE could inform improved systems for producing other challenging membrane proteins for structural and functional studies.

  • Synthetic Biology Modules: The Na+-NQR complex components could serve as modular elements in synthetic circuits requiring energy transduction or ion gradient generation, expanding the toolkit for synthetic biology applications.

  • Biocontainment Strategies: Engineered dependency on Na+-NQR function could be exploited to create biocontainment systems for genetically modified organisms used in industrial or environmental applications.

Biomimetic Materials and Nanotechnology:

The natural ability of nqrE to participate in directed ion transport across membranes could inspire the development of biomimetic materials for:

  • Selective ion filtration systems

  • Energy-efficient desalination technologies

  • Directional transport in nanofluidic devices

  • Self-assembling nanoscale machines with ion-powered motility

These diverse applications highlight how fundamental research on the structure and function of nqrE contributes not only to our understanding of bacterial bioenergetics and potential therapeutic targets but also to broad technological innovations across multiple fields. The unique electron transfer and ion translocation capabilities of this system provide a rich source of inspiration for biomimetic technologies with potential applications in sustainable energy, environmental monitoring, and advanced materials .

What are the most significant research gaps in our understanding of Y. pestis nqrE?

Despite progress in characterizing the Na+-translocating NADH-quinone reductase complex in various bacterial species, significant research gaps remain in our understanding of Y. pestis nqrE. These knowledge gaps represent critical targets for future research efforts:

  • High-Resolution Structural Characterization: While related Na+-NQR complexes have been studied structurally, a high-resolution structure of the Y. pestis complex remains elusive. This gap limits our understanding of the specific arrangements and interactions of nqrE within the complex and hampers structure-based inhibitor design.

  • Na+ Translocation Pathway: The precise pathway through which Na+ ions move across the membrane via nqrE and partner subunits remains poorly defined. Identifying the key residues that form this pathway and understanding how conformational changes facilitate ion movement represents a fundamental knowledge gap.

  • Regulatory Mechanisms: How Y. pestis modulates Na+-NQR activity in response to changing environmental conditions, particularly during host transition, remains largely unexplored. The regulatory networks controlling nqrE expression and function in different phases of the bacterial life cycle require further investigation.

  • Host-Pathogen Interface: The potential role of Na+-NQR activity in Y. pestis virulence and host immune evasion strategies has not been systematically investigated. Understanding whether this energy-generating system contributes directly or indirectly to pathogenesis would provide valuable insights.

  • Interplay with Alternative Respiratory Pathways: How Na+-NQR functions in concert with other respiratory chain components in Y. pestis under various environmental conditions remains unclear. The conditions under which this complex becomes essential for bacterial survival are not fully delineated.

These research gaps highlight the need for integrated approaches combining structural biology, biochemistry, molecular genetics, and infection models to develop a comprehensive understanding of nqrE function in Y. pestis. Addressing these gaps will not only advance fundamental knowledge but also inform therapeutic development against this important human pathogen .

How could interdisciplinary approaches advance nqrE research and applications?

Interdisciplinary approaches that bridge traditionally separate fields offer powerful strategies to overcome the complex challenges in nqrE research and accelerate both fundamental understanding and practical applications. The following framework outlines key interdisciplinary intersections and their potential contributions:

Integrating Computational and Experimental Approaches:

The synergy between computational modeling and experimental validation can rapidly advance understanding of nqrE structure and function:

  • Molecular Dynamics Simulations combined with site-directed mutagenesis can map ion translocation pathways and identify critical residues for Na+ coordination.

  • Quantum Mechanics/Molecular Mechanics (QM/MM) calculations integrated with spectroscopic measurements can elucidate electron transfer mechanisms between the unique cofactors and their coupling to ion movement.

  • Machine Learning Algorithms applied to sequence-structure-function relationships across bacterial species can identify hidden patterns in nqrE evolution and predict functional consequences of mutations.

Bridging Structural Biology and Systems Biology:

Engineering-Biology Interface:

  • Synthetic Biology Approaches: Designing modified versions of nqrE with enhanced or altered functions through rational protein engineering and directed evolution.

  • Nanotechnology Integration: Incorporating purified or reconstituted nqrE into nanoscale devices for energy transduction or sensing applications.

  • Biomaterials Science: Developing biomimetic membranes with incorporated nqrE for selective ion transport or energy harvesting.

Clinical-Basic Science Collaboration:

The translation of nqrE research into therapeutic applications requires close collaboration between basic scientists and clinical researchers:

  • Pharmacology-Structural Biology Integration: Structure-guided drug design targeting nqrE, informed by medicinal chemistry principles and pharmacokinetic considerations.

  • Microbiology-Infectious Disease Interface: Validation of nqrE as a therapeutic target through collaborations with infectious disease specialists studying Y. pestis pathogenesis.

  • Biotechnology-Medical Diagnostics: Development of nqrE-based diagnostics for rapid detection of Y. pestis in clinical samples.

These interdisciplinary approaches not only accelerate progress in understanding nqrE function but also maximize the translational impact of this research. By bringing together diverse expertise and methodologies, researchers can address the complex challenges associated with membrane protein research and develop innovative applications across multiple fields .

What are the broader implications of nqrE research for our understanding of bacterial bioenergetics and pathogenesis?

The study of nqrE within the Na+-translocating NADH-quinone reductase complex has far-reaching implications that extend well beyond this specific protein, influencing our fundamental understanding of bacterial bioenergetics, evolution, and pathogenesis. These broader implications include:

Evolutionary Perspectives on Energy Conservation:

  • Diversification of Ion-Motive Force Generation: Research on Na+-NQR provides insights into how bacteria have evolved diverse mechanisms for generating electrochemical gradients. Unlike the more common H+-translocating respiratory complexes, the Na+-specific machinery represents an alternative evolutionary solution to energy conservation, potentially offering advantages in specific ecological niches.

  • Adaptations to Environmental Constraints: The presence of Na+-NQR in specific bacterial lineages, including important pathogens, suggests selective advantages of Na+-based bioenergetics in certain environments. Understanding these advantages could illuminate how bacteria adapt their energetic systems to environmental challenges.

  • Evolution of Respiratory Chain Complexity: The unique cofactor composition and structural organization of Na+-NQR (including nqrE) represent a distinct evolutionary path from the mitochondrial-type respiratory complexes, showcasing the diversity of electron transfer solutions that have evolved.

Paradigm Shifts in Bioenergetics:

Conceptual AdvanceSupporting EvidenceSignificance
Multiple coupling mechanismsNa+-NQR uses different mechanisms than Complex I for coupling electron transfer to ion transportExpands our understanding of energy transduction principles
Diverse redox cofactor arrangementsUnique arrangement of FAD, FMN, riboflavin and FeS centers in Na+-NQRReveals evolutionary plasticity in electron transfer chains
Alternative ion gradientsNa+ gradient generation instead of H+ in specific bacteriaDemonstrates metabolic adaptability to various environments

Implications for Bacterial Pathogenesis:

  • Metabolic Adaptation During Infection: The ability to generate Na+ gradients may provide energetic advantages during specific stages of infection, particularly in host environments with altered pH or ion composition. This could contribute to the survival of Y. pestis during transitions between vector and mammalian hosts.

  • Novel Virulence Connections: Energy metabolism is increasingly recognized as intertwined with virulence expression. Na+-NQR activity may influence the expression of virulence factors in Y. pestis through effects on cellular energetics and redox balance.

  • Antibiotic Resistance Mechanisms: Membrane energetics affects susceptibility to many antibiotics. The unique properties of Na+-NQR-based energy generation could influence intrinsic resistance patterns in Y. pestis and other pathogens utilizing this system.

Broader Technological and Conceptual Impact:

The distinctive properties of Na+-NQR and its component subunits like nqrE have stimulated new approaches in:

  • Bioinspired energy conversion systems

  • Selective ion transport technologies

  • Evolutionary models of protein complex assembly

  • Conceptual frameworks for coupling electron and ion movement

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.