Recombinant Yersinia pestis bv. Antiqua NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Description

Functional Role in Yersinia pestis

The nuoA subunit is part of NDH-1, which transfers electrons from NADH to ubiquinone while translocating protons across the membrane, generating a proton gradient essential for ATP synthesis .

Key Functions:

  • Electron Transport: Facilitates electron transfer via FMN and iron-sulfur clusters.

  • Proton Translocation: Translocates four protons per two electrons transferred.

  • Bioenergetic Regulation: Integral to maintaining redox balance and energy conservation .

Production and Purification

The recombinant protein is expressed in E. coli and purified to >90% purity via SDS-PAGE analysis.

ParameterSpecificationSource
Expression SystemE. coli
TagN-terminal His-tag
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0
Purity>90% (SDS-PAGE)
Reconstitution0.1–1.0 mg/mL in deionized water; 50% glycerol recommended for storage

Diagnostic Tools

Recombinant nuoA is utilized in ELISA kits for detecting Y. pestis antigens, enabling precise serological testing .

Biovar Classification Studies

Genomic comparisons of Y. pestis biovars (antiqua, mediaevalis, orientalis) reveal distinct metabolic profiles:

BiovarGlycerolArabinoseNitrateAssociated PandemicSource
AntiquaPositivePositivePositiveJustinian Plague
MediaevalisPositivePositiveNegativeBlack Death
OrientalisNegativePositivePositiveModern Plague

A. Gene Reduction in Y. pestis

Comparative genomics of Y. pestis and Y. pseudotuberculosis highlight deletions in metabolic genes (e.g., glpD in orientalis strains), reflecting adaptation to host environments .

Strain-Specific Variations

The nuoA gene in antiqua strains (e.g., Antiqua, Nepal516) shows 453 SNPs in coding regions, underscoring genetic divergence within biovars .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%, provided as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
nuoA; YpAngola_A1816; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-166
Protein Length
full length protein
Species
Yersinia pestis bv. Antiqua (strain Angola)
Target Names
nuoA
Target Protein Sequence
MRMSTTTEIIAHHWAFAVFLIGAVGLCGLMLLGAYFLGGRAQARAKNVPYESGIDSVGSA RMRLSAKFYLVAMFFVIFDVEALYLYAWSISIRESGWIGFIEAAIFILVLLAGLFYLVRI GALDWTPTRSNRRVSKPSTVRYASSHPQDISQELSVAGSQQANESR
Uniprot No.

Target Background

Function

NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediaries. In this organism, ubiquinone is believed to be the primary electron acceptor. The enzyme couples this redox reaction to proton translocation; four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred, thus conserving redox energy within a proton gradient.

Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of nuoA in Yersinia pestis biovar Antiqua?

The nuoA gene in Y. pestis biovar Antiqua is part of the nuo operon encoding the NADH-quinone oxidoreductase complex (Complex I), which plays a critical role in cellular respiration. The complete genome of Y. pestis Antiqua is approximately 4.7 Mb and encodes 4,138 open reading frames . The nuoA gene is typically located within the nuo operon alongside other subunits of the NADH-quinone oxidoreductase complex. Researchers should note that Y. pestis strains, including the Antiqua biovar, exhibit strain-specific genomic rearrangements, insertions, and deletions that may affect the genetic context of the nuoA gene . When designing experiments targeting this gene, it's essential to consider the specific genomic architecture of the Y. pestis Antiqua strain you're working with.

How does the nuoA sequence in Y. pestis biovar Antiqua differ from other Y. pestis biovars?

Comparative genomic analyses have revealed single nucleotide polymorphisms (SNPs) among different Y. pestis strains, with 453 SNPs identified in protein-coding regions across five sequenced Y. pestis genomes . When studying nuoA specifically, researchers should perform sequence alignments between Antiqua and other biovars (such as Medievalis and Orientalis) to identify strain-specific variations. These polymorphisms can significantly impact protein structure and function, potentially affecting electron transport chain efficiency and consequently bacterial metabolism. Methodology should include PCR amplification of the nuoA gene from different strains, followed by sequencing and bioinformatic analysis using tools like BLAST, Clustal Omega, or MEGA for phylogenetic tree construction.

What is the role of nuoA in Y. pestis metabolism and virulence?

The nuoA protein, as a component of NADH-quinone oxidoreductase, participates in the initial steps of the electron transport chain, contributing to energy production through oxidative phosphorylation. While not traditionally classified as a virulence factor like the F1 antigen or Pla protease , metabolic genes can significantly impact pathogenesis. Genome-scale metabolic reconstructions have demonstrated that Y. pestis primary metabolism can be shaped by virulence-associated secondary metabolite systems . Researchers investigating nuoA's role in virulence should consider:

  • Creating nuoA deletion mutants to assess growth kinetics in various media

  • Evaluating survival under different environmental conditions (temperature shifts, pH changes)

  • Measuring bacterial burden in animal infection models when the nuoA gene is deleted or modified

  • Transcriptomic analysis to identify co-regulated genes during host infection

How can I develop recombinant expression systems for Y. pestis Antiqua nuoA that maintain native protein function?

Successful recombinant expression of Y. pestis Antiqua nuoA requires careful consideration of expression vectors, host systems, and purification strategies. A methodological approach includes:

  • Vector selection: For membrane proteins like nuoA, vectors with moderate promoter strength (e.g., pET-28a with T7lac promoter) often provide better results than high-expression systems.

  • Expression hosts: Consider the following options with corresponding advantages:

Host SystemAdvantagesLimitations
E. coli C43(DE3)Optimized for membrane proteinsMay introduce E. coli-specific modifications
E. coli BL21(DE3) pLysSTight regulation of expressionLimited post-translational modifications
Y. pseudotuberculosisClosely related, similar membrane compositionRequires specialized genetic tools
  • Induction conditions: Low-temperature induction (16-20°C) and reduced IPTG concentration (0.1-0.5 mM) often improve folding.

  • Verification of function: Assess electron transfer activity using NADH:ubiquinone oxidoreductase assays with artificial electron acceptors.

For membrane proteins like nuoA, solubilization requires careful detergent selection. A detergent screening approach may include testing n-dodecyl-β-D-maltoside (DDM), digitonin, and lauryl maltose neopentyl glycol (LMNG) at various concentrations to identify optimal conditions for maintaining protein structure and function.

What approaches can be used to study nuoA interactions with other subunits of the NADH-quinone oxidoreductase complex in Y. pestis Antiqua?

The NADH-quinone oxidoreductase complex consists of multiple subunits that must assemble correctly for proper function. Interactomics approaches, as highlighted in Y. pestis virulence studies , can reveal critical protein-protein interactions. Recommended methodologies include:

  • Bacterial two-hybrid assays: Use systems adapted for membrane protein analysis to detect direct interactions between nuoA and other subunits.

  • Co-immunoprecipitation: Develop specific antibodies against nuoA (similar to antibody development approaches for F1 antigen ) or use epitope-tagged versions to pull down interacting partners.

  • Cross-linking coupled with mass spectrometry (XL-MS): Apply membrane-permeable cross-linkers followed by protein digestion and LC-MS/MS analysis to identify proximity-based interactions.

  • Blue native PAGE: Preserve native protein complexes through mild solubilization conditions and non-denaturing electrophoresis to analyze intact NADH-quinone oxidoreductase complexes.

  • Cryo-electron microscopy: For structural characterization of the complete complex, including the position and orientation of nuoA relative to other subunits.

How do environmental conditions affect nuoA expression in Y. pestis Antiqua during infection cycles?

Y. pestis experiences dramatic environmental shifts during its life cycle, transitioning between flea vectors (26-30°C) and mammalian hosts (37°C). Transcriptomics studies have revealed that such environmental changes significantly modulate gene expression patterns in Y. pestis . To investigate nuoA expression under different conditions:

  • qRT-PCR analysis: Measure nuoA transcript levels after exposure to different temperatures, pH values, nutrient limitations, and host factors.

  • Promoter-reporter fusions: Generate fusions between the nuoA promoter region and reporter genes (GFP, luciferase) to monitor expression in real-time.

  • RNA-Seq: Perform global transcriptomic analysis under different conditions to identify co-regulated genes and regulatory networks involving nuoA.

  • ChIP-Seq: Identify transcription factors binding to the nuoA promoter region under various conditions.

Expected expression patterns may include upregulation during transition to nutrient-limited environments, where efficient energy conservation becomes critical for survival.

What are the critical controls needed when performing knockout studies of nuoA in Y. pestis Antiqua?

When designing knockout experiments for nuoA in Y. pestis Antiqua, researchers must implement several critical controls:

Control TypePurposeImplementation
Wild-type strainBaseline comparisonInclude parental Y. pestis Antiqua strain in all experiments
ComplementationVerify phenotype is due to nuoA deletionReintroduce nuoA on plasmid or in neutral chromosomal site
Polar effect controlRule out effects on downstream genesCreate point mutations that disrupt nuoA function without affecting operon structure
Growth rate normalizationAccount for general growth defectsNormalize experimental measurements to growth rate or cell number
Non-pathogenic Y. pestis strainBiosafety alternativeConsider using Y. pestis strain 91001 (human-avirulent) for initial studies

For genetic manipulation of Y. pestis, researchers should consider established techniques like lambda Red recombineering or CRISPR-Cas9 systems adapted for Y. pestis. Growth assays should include both rich media and minimal media with varying carbon sources to fully characterize metabolic defects resulting from nuoA deletion.

How can I design recombinant nuoA constructs to study the impact of Y. pestis Antiqua-specific SNPs on protein function?

To investigate the functional significance of Y. pestis Antiqua-specific SNPs in nuoA:

  • Identify strain-specific SNPs: Compare nuoA sequences across Y. pestis biovars and closely related species like Y. pseudotuberculosis using comprehensive genomic data .

  • Predict functional impacts: Use structural prediction tools to assess how identified SNPs might affect protein folding, membrane insertion, or interaction interfaces.

  • Create SNP variants: Use site-directed mutagenesis to generate a panel of recombinant nuoA constructs with:

    • Antiqua-specific SNPs introduced into background sequences from other biovars

    • Reverse mutations (changing Antiqua-specific residues to those found in other biovars)

  • Functional testing: Assess each variant's ability to:

    • Complement nuoA deletion mutants

    • Assemble into the NADH-quinone oxidoreductase complex

    • Support electron transport activity using biochemical assays

This approach can provide insights into how evolutionary changes in nuoA might contribute to the unique metabolic characteristics of the Antiqua biovar.

How should I interpret contradictory results between in vitro and in vivo studies of nuoA function in Y. pestis Antiqua?

Discrepancies between in vitro biochemical studies and in vivo infection experiments are common when studying metabolic genes like nuoA. When faced with contradictory results:

  • Consider environmental context: Y. pestis experiences dramatically different conditions in laboratory media versus host environments. The bacterium undergoes extensive transcriptional reprogramming in response to environmental signals , which may affect nuoA function and importance.

  • Evaluate redundancy: Alternative electron transport chain components may compensate for nuoA deficiency in specific environments but not others.

  • Assess technical factors: Differences in experimental conditions, strain backgrounds, or measurement techniques may contribute to discrepancies.

  • Design bridging experiments: Use intermediate models like macrophage cell cultures or ex vivo tissue samples to bridge the gap between in vitro and in vivo studies.

  • Apply multi-omics approaches: Combine transcriptomics, proteomics, and metabolomics to develop a more comprehensive understanding of nuoA's role in different contexts .

What bioinformatic approaches can be used to analyze nuoA conservation across Y. pestis lineages in the context of metabolic adaptation?

To investigate nuoA conservation and its relationship to metabolic adaptation:

  • Sequence conservation analysis:

    • Collect nuoA sequences from multiple Y. pestis isolates, including representatives from all biovars

    • Calculate conservation scores (dN/dS ratios) to identify regions under purifying or diversifying selection

    • Create conservation heat maps mapped to predicted protein structure

  • Phylogenetic analysis:

    • Construct phylogenetic trees based on nuoA sequences

    • Compare with whole-genome phylogenies to identify potential horizontal gene transfer events

    • Correlate nuoA sequence variants with known phenotypic differences between strains

  • Metabolic modeling:

    • Integrate nuoA sequence data into genome-scale metabolic reconstructions

    • Simulate the effects of observed sequence variations on electron transport efficiency

    • Predict metabolic consequences in different environmental niches

  • Structural bioinformatics:

    • Model nuoA structure using homology modeling

    • Map conservation data and SNPs onto structural models

    • Predict effects on protein stability and interaction interfaces

This integrated approach can reveal whether nuoA variations represent neutral evolution or adaptive changes that contributed to Y. pestis biovar diversification.

What are the main challenges in isolating and purifying recombinant Y. pestis Antiqua nuoA, and how can they be overcome?

Membrane proteins like nuoA present significant purification challenges:

  • Expression toxicity: Overexpression of membrane proteins can be toxic to host cells.

    • Solution: Use tightly regulated expression systems and lower induction temperatures (16-20°C).

  • Inclusion body formation: Improper folding leads to aggregation.

    • Solution: Consider fusion partners like MBP (maltose-binding protein) or SUMO to enhance solubility.

  • Detergent selection: Inappropriate detergents can destabilize protein structure.

    • Solution: Systematic screening of detergents using thermal shift assays to identify stabilizing conditions.

  • Maintaining protein-protein interactions: nuoA functions as part of a multi-subunit complex.

    • Solution: Consider co-expression of interacting subunits or purification of entire subcomplexes.

  • Low yields: Membrane proteins typically express at lower levels than soluble proteins.

    • Solution: Scale-up cultures and optimize extraction conditions; consider expression in specialized systems like Lemo21(DE3).

A methodical approach involving small-scale expression trials with various conditions followed by fluorescence-based thermal stability assays can help identify optimal purification conditions before scaling up.

How can I adapt antibody-based detection methods for specific recognition of Y. pestis Antiqua nuoA?

Developing specific antibodies against nuoA requires careful antigen design and validation approaches similar to those used for other Y. pestis antigens :

  • Antigen design options:

    • Recombinant full-length nuoA (challenging due to membrane protein nature)

    • Synthetic peptides corresponding to exposed epitopes (based on structural predictions)

    • Fusion constructs with carrier proteins for enhanced immunogenicity

  • Antibody generation platforms:

    • Phage display library screening (as demonstrated for F1 antigen)

    • Monoclonal antibody development using hybridoma technology

    • Recombinant antibody engineering approaches

  • Specificity validation:

    • Cross-reactivity testing against nuoA from related Yersinia species

    • Testing against Y. pestis strains with nuoA deletions or mutations

    • Competitive binding assays with purified nuoA protein

  • Application optimization:

    • For fixed samples: Optimize fixation methods to preserve nuoA epitopes

    • For live bacteria: Develop protocols that maintain cell viability while allowing antibody access

    • For biochemical assays: Determine optimal detergent conditions that preserve antibody binding

The workflow for antibody development should include rigorous specificity testing against F1-negative Y. pestis strains like Nairobi to ensure that detection is specific to nuoA rather than other surface markers.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.