Recombinant Yersinia pestis bv. Antiqua p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Yersinia pestis bv. Antiqua p-hydroxybenzoic acid efflux pump subunit AaeA (AaeA)

Recombinant Yersinia pestis bv. Antiqua p-hydroxybenzoic acid efflux pump subunit AaeA (AaeA) refers to a protein that is produced using recombinant DNA technology, based on the AaeA protein found in the Yersinia pestis bv. Antiqua strain . AaeA is a subunit of an efflux pump involved in the transport of p-hydroxybenzoic acid (pHBA) and potentially other aromatic carboxylic acids out of the bacterial cell . Efflux pumps are crucial for bacterial survival as they help in removing toxic compounds, thus conferring resistance to certain substances .

Yersinia pestis, the bacterium responsible for plague, is classified into biovars such as antiqua, medievalis, and orientalis, based on their biochemical characteristics . The antiqua biovar is associated with long-term plague foci in Africa and central Asia .

Function and Mechanism

AaeA is a component of an efflux system that includes AaeB . Efflux systems in bacteria are diverse, ranging from those with broad substrate specificity to those highly specific for certain compounds . These systems often consist of multiple proteins working together to transport substrates across the bacterial cell membrane .

The AaeA protein belongs to the putative efflux transport (PET) family, characterized by having 12 predicted transmembrane segments, indicating its localization in the membrane . It is believed that AaeA and AaeB work together to eliminate compounds when they accumulate to toxic levels within the cell, acting as a metabolic relief valve .

Production and Characteristics

Recombinant AaeA is produced in E. coli by fusing a His tag to the N-terminal of the AaeA protein (1-311aa) . The recombinant protein is available for research purposes, often supplied in a Tris-based buffer with 50% glycerol for stability . It is recommended to store the protein at -20℃ or -80℃ to prevent degradation, and repeated freezing and thawing should be avoided .

Table 1: Recombinant AaeA Protein Characteristics

CharacteristicDescription
Protein Namep-hydroxybenzoic acid efflux pump subunit AaeA
Short NamepHBA efflux pump protein A
Gene NameaaeA
Ordered Locus NamesVaries depending on the strain (e.g., YpAngola_A1176 , YPA_3698 )
Expression Region1-311 amino acids
AA SequenceMSTFSLKIIRVGITVLVVVLAVIAIFNVWAFYTESPWTRDAKFTADVVAIAPDVSGLLTEVPVKDNQLVQKGQILFVIDQPRYQQALAEAEADVAYYQTLAAEKQRESSRRHRLGIQALSQEEIDQASNVLQTVQHQLAKAIAVRDLARLDLERTTVRAPAEGWVTNLNVHAGEFINRGATAVALVKKDTFYILAYLEETKLEGVKPGYRAEITPLGSNRILHGTVDSISAGVTNSSSSADSKGLATIDNNLEWVRLAQRVPVKIHLDSEDQQYLYPAGTTATVVITGPNDRDPHQASPMTKLMHRLREFG
SpeciesYersinia pestis bv. Antiqua
Tag InfoHis-tagged
Storage BufferTris-based buffer, 50% glycerol
Storage-20℃, for extended storage, conserve at -20℃ or -80℃

Role in Bacterial Physiology

The AaeA protein, along with AaeB, facilitates the efflux of aromatic carboxylic acids like pHBA . This efflux mechanism is crucial for maintaining cellular homeostasis by preventing the accumulation of toxic metabolites . The E. coli homologue, initially named YhcP, was found to be upregulated in response to pHBA, indicating its role in pHBA resistance .

The broader physiological role of such efflux systems can be seen as a "metabolic relief valve," mitigating the toxic effects of imbalanced metabolism . By exporting specific compounds, bacteria can maintain optimal intracellular conditions, particularly when metabolic pathways lead to an overproduction of certain metabolites .

Research Applications

Recombinant AaeA is used in various research applications, including:

  • ELISA assays: Recombinant AaeA can be utilized in Enzyme-Linked Immunosorbent Assays (ELISA) for detecting and quantifying antibodies against Yersinia pestis .

  • Protein interaction studies: It can be used to study its interaction with other proteins like AaeB and to elucidate the mechanism of the AaeAB efflux pump .

  • Drug discovery: Understanding the function of AaeA can aid in the development of novel drugs that target efflux pumps, thereby increasing the efficacy of antibiotics .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
aaeA; YpAngola_A1176; p-hydroxybenzoic acid efflux pump subunit AaeA; pHBA efflux pump protein A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
full length protein
Species
Yersinia pestis bv. Antiqua (strain Angola)
Target Names
aaeA
Target Protein Sequence
MSTFSLKIIRVGITVLVVVLAVIAIFNVWAFYTESPWTRDAKFTADVVAIAPDVSGLLTE VPVKDNQLVQKGQILFVIDQPRYQQALAEAEADVAYYQTLAAEKQRESSRRHRLGIQALS QEEIDQASNVLQTVQHQLAKAIAVRDLARLDLERTTVRAPAEGWVTNLNVHAGEFINRGA TAVALVKKDTFYILAYLEETKLEGVKPGYRAEITPLGSNRILHGTVDSISAGVTNSSSSA DSKGLATIDNNLEWVRLAQRVPVKIHLDSEDQQYLYPAGTTATVVITGPNDRDPHQASPM TKLMHRLREFG
Uniprot No.

Target Background

Function
Forms an efflux pump in conjunction with AaeB.
Database Links
Protein Families
Membrane fusion protein (MFP) (TC 8.A.1) family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the function of the p-hydroxybenzoic acid efflux pump subunit AaeA in Yersinia pestis?

The p-hydroxybenzoic acid efflux pump subunit AaeA in Yersinia pestis functions as a component of bacterial efflux systems that transport substances out of the cell. Like other efflux pumps, AaeA likely contributes to expelling toxic compounds, including antibiotics, thus potentially contributing to antimicrobial resistance mechanisms. Efflux pumps represent a major route to decreased antibiotic susceptibility in many bacteria . While the specific substrates of Y. pestis AaeA have not been fully characterized in the provided research, its structural and functional similarity to other bacterial efflux systems suggests it plays a role in exporting p-hydroxybenzoic acid and potentially other aromatic compounds from the bacterial cytoplasm, thereby contributing to bacterial survival under various environmental stresses.

How does Yersinia pestis cause disease, and what role might efflux pumps play in its pathogenesis?

Yersinia pestis is the causative agent of bubonic, septicemic, and pneumonic plague. Primary pneumonic plague is particularly severe, with nearly 100% lethality within 4-7 days without antibiotic intervention . The bacterium's primary virulence mechanism is the Ysc type 3 secretion system (T3SS), which injects bacterial effector proteins called Yops into host cells to prevent phagocytosis and limit innate immune signaling .

While the search results don't directly address AaeA's role in pathogenesis, efflux pumps generally contribute to pathogenesis through:

  • Antibiotic resistance - allowing bacteria to survive therapeutic interventions

  • Expulsion of host antimicrobial compounds - enhancing bacterial survival

  • Export of bacterial virulence factors - facilitating host colonization and infection

Research on other Y. pestis proteins like BipA shows they can significantly affect bacterial survival in the lung and disease progression , suggesting that various membrane proteins, potentially including AaeA, contribute to the complex pathogenesis of plague.

How do experimental conditions affect the stability and activity of recombinant Y. pestis AaeA protein?

The stability and activity of recombinant Y. pestis AaeA protein are significantly influenced by experimental conditions, requiring careful optimization for research applications. Based on the available data for the commercially available recombinant protein, the following parameters should be considered:

Storage conditions:

  • Long-term storage should be at -20°C/-80°C

  • Repeated freeze-thaw cycles should be avoided

  • Working aliquots can be stored at 4°C for up to one week

Buffer composition:

  • Tris/PBS-based buffer with 6% Trehalose at pH 8.0 is recommended for storage

  • For reconstitution, deionized sterile water is recommended to achieve a concentration of 0.1-1.0 mg/mL

  • Addition of 5-50% glycerol (final concentration) is advised for long-term storage

For experimental work, researchers should consider that membrane proteins like AaeA typically require detergents or lipid environments to maintain their native conformation and activity. Functional assays would likely require incorporation into membrane mimetics such as liposomes or nanodiscs to properly assess efflux activity.

What methods can be used to assess the contribution of AaeA to antibiotic resistance in Yersinia pestis?

Assessment of AaeA's contribution to antibiotic resistance in Y. pestis requires a multifaceted experimental approach. While the provided search results don't detail specific methods for AaeA, similar approaches to those used for studying other efflux systems can be applied:

Genetic approaches:

  • Gene deletion studies - Creating ΔaaeA mutants and comparing their antibiotic susceptibility profiles to wild-type strains. This approach was used successfully with other Y. pestis proteins like BipA .

  • Complementation experiments - Reintroducing the aaeA gene to confirm that observed phenotypes are directly attributable to AaeA.

  • Overexpression studies - Examining the effects of aaeA overexpression on antibiotic resistance.

Functional assays:

  • Minimum inhibitory concentration (MIC) determination - Comparing MICs of various antibiotics between wild-type and AaeA-deficient strains.

  • Efflux inhibitor studies - Using known efflux pump inhibitors to assess their impact on antibiotic susceptibility.

  • Substrate accumulation assays - Measuring the intracellular accumulation of fluorescent dyes or labeled antibiotics.

Molecular techniques:

  • RT-qPCR to measure aaeA expression under various antibiotic exposures

  • Reporter gene assays to monitor promoter activity

  • Protein-protein interaction studies to identify partners in the efflux machinery

These methodologies would provide a comprehensive understanding of AaeA's role in antibiotic resistance, similar to studies performed on other efflux systems like AcrAB-TolC mentioned in search result .

How does the AaeA protein from Y. pestis compare structurally and functionally to homologous proteins in other bacterial species?

The AaeA protein from Y. pestis shares structural and functional similarities with homologous proteins in other bacterial species, particularly those in Enterobacteriaceae. Comparative analysis reveals several important features:

Sequence comparison with E. coli O17:K52:H18 AaeA:
Both proteins function as subunits of p-hydroxybenzoic acid efflux pumps , suggesting conservation of this mechanism across species. Although the complete E. coli sequence from result is truncated, the available segment shows similarity in protein organization, with both containing transmembrane domains characteristic of membrane transport proteins.

Functional domains:
Y. pestis AaeA (311 aa) and the E. coli homolog display conserved structural features typical of membrane transport proteins, including:

  • N-terminal transmembrane regions

  • Cytoplasmic domains involved in substrate recognition

  • Membrane-spanning α-helices that form the transport channel

Evolutionary significance:
The conservation of AaeA across different bacterial species suggests fundamental importance in bacterial physiology. The evolutionary pressure to maintain these efflux systems likely relates to their role in expelling toxic compounds from natural environments, with antibiotic resistance being a more recent adaptation of this mechanism.

For researchers, these comparisons provide insight into universal mechanisms of efflux systems and potential broad-spectrum targets for antimicrobial development.

What are the optimal conditions for expressing and purifying recombinant Y. pestis AaeA protein?

Expressing and purifying membrane proteins like Y. pestis AaeA presents significant technical challenges. Based on available information and standard protocols for similar proteins, the following methodological recommendations can be made:

Expression system:
E. coli has been successfully used as an expression host for recombinant Y. pestis AaeA . For membrane proteins, specialized E. coli strains like C41(DE3) or C43(DE3) often yield better results by accommodating the additional membrane protein load.

Expression constructs:

  • The full-length protein (1-311 amino acids) with an N-terminal His-tag has been successfully produced

  • The tag placement should be carefully considered as it may affect protein folding or function

Induction conditions:

  • Lower temperatures (16-25°C) often improve membrane protein folding

  • Reduced inducer concentrations and extended expression times may increase yields

  • Addition of membrane-stabilizing compounds like glycerol (5-10%) to growth media can improve expression

Purification protocol:

  • Cell lysis: Gentle methods like enzymatic lysis with lysozyme followed by mild sonication

  • Membrane isolation: Ultracentrifugation to separate membrane fractions

  • Solubilization: Use of appropriate detergents (e.g., DDM, LDAO, or OG) at 1-2% concentration

  • Affinity purification: Utilizing His-tag with immobilized metal affinity chromatography

  • Further purification: Size exclusion chromatography to obtain homogeneous protein

Buffer optimization:

  • Tris/PBS-based buffers at pH 8.0 are suitable

  • Addition of stabilizers like 6% trehalose improves protein stability

Quality control:

  • SDS-PAGE analysis to confirm purity (target >90%)

  • Western blotting to verify identity

  • Mass spectrometry to confirm sequence integrity

These methodological considerations provide a framework for researchers to successfully express and purify functional Y. pestis AaeA protein for subsequent experimental applications.

How can researchers effectively design experiments to study the role of AaeA in Yersinia pestis pathogenesis?

Designing robust experiments to study AaeA's role in Y. pestis pathogenesis requires careful consideration of multiple factors. Drawing from approaches used with other Y. pestis virulence factors , the following experimental design framework is recommended:

In vitro studies:

  • Gene deletion and complementation:

    • Create ΔaaeA mutants using allelic exchange techniques

    • Generate complemented strains (ΔaaeA::aaeA) to verify phenotypes

    • Include appropriate controls (e.g., wild-type strains)

  • Cellular infection models:

    • Assess bacterial adhesion, invasion, and intracellular survival in relevant cell types (macrophages, neutrophils, pneumocytes)

    • Compare wild-type, ΔaaeA, and complemented strains in these assays

    • Quantify host cell responses (cytokine production, degranulation, ROS generation)

  • Antibiotic resistance profiling:

    • Determine MICs for clinically relevant antibiotics

    • Assess antibiotic resistance under conditions mimicking in vivo environments

In vivo studies:

  • Animal infection models:

    • The murine model of primary pneumonic plague is well-established for Y. pestis

    • Monitor bacterial burdens in lungs and dissemination to other organs

    • Assess survival rates and disease progression

  • Neutrophil depletion experiments:

    • Similar to studies with BipA , assess if neutrophil depletion affects the attenuated virulence of ΔaaeA mutants

    • Use anti-Ly-6G antibody treatment to deplete neutrophils in mouse models

  • Imaging techniques:

    • Utilize fluorescently labeled bacteria to track localization in tissues

    • Employ histopathological analysis to assess tissue damage and immune cell infiltration

Molecular mechanism studies:

  • Transcriptomics:

    • RNA-seq to compare gene expression profiles between wild-type and ΔaaeA strains

    • Identify regulatory networks affected by AaeA absence

  • Protein interaction studies:

    • Co-immunoprecipitation to identify protein partners

    • Bacterial two-hybrid assays to map interaction networks

  • Structural biology:

    • X-ray crystallography or cryo-EM to determine protein structure

    • In silico modeling to predict substrate binding and transport mechanisms

This comprehensive experimental approach would provide valuable insights into AaeA's role in Y. pestis pathogenesis, potentially identifying new therapeutic targets for plague treatment.

What experimental controls are critical when evaluating the substrate specificity of the AaeA efflux pump?

When evaluating substrate specificity of the AaeA efflux pump, implementing appropriate experimental controls is essential for generating reliable and interpretable data. The following critical controls should be incorporated:

Genetic controls:

  • Wild-type strain - Establishes baseline efflux activity

  • ΔaaeA deletion mutant - Confirms loss of specific efflux function

  • Complemented strain (ΔaaeA::aaeA) - Verifies phenotype restoration

  • Overexpression strain - Demonstrates enhanced efflux of specific substrates

  • Strain with mutations in key residues - Identifies critical amino acids for substrate specificity

Substrate controls:

  • Known p-hydroxybenzoic acid - As the namesake substrate, should show clear efflux

  • Structural analogs with varying modifications - To map the substrate binding pocket requirements

  • Negative control compounds - Molecules not expected to be AaeA substrates

  • Competitive substrates - To demonstrate specificity through competition assays

  • Fluorescently labeled substrates - For direct visualization of efflux activity

Inhibitor controls:

  • General efflux pump inhibitors (e.g., carbonyl cyanide m-chlorophenylhydrazone, CCCP) - Disrupt proton motive force

  • Specific competitive inhibitors - If available, to demonstrate selectivity

  • Vehicle controls - To exclude solvent effects when using DMSO or ethanol for compound solubilization

Physiological condition controls:

  • pH variations - Test efflux at different pH levels to determine optimal conditions

  • Temperature variations - Assess temperature dependence of efflux activity

  • Growth phase comparisons - Examine expression and activity in different bacterial growth phases

  • Stress condition testing - Evaluate activity under various environmental stressors

Methodological controls:

  • Time-course measurements - To capture the kinetics of efflux

  • Concentration gradients - To determine concentration-dependent effects

  • Technical replicates - Minimum of three to assess reproducibility

  • Biological replicates - Independent experiments with different bacterial cultures

The inclusion of these systematic controls would allow researchers to definitively characterize the substrate specificity of the AaeA efflux pump, contributing valuable knowledge to our understanding of Y. pestis antimicrobial resistance mechanisms.

What statistical approaches are most appropriate for analyzing data from AaeA functional studies?

For bacterial growth and survival assays:

  • Growth curve analysis:

    • Area under the curve (AUC) comparisons using Student's t-test or ANOVA

    • Growth rate calculations using regression analysis

    • Time-to-threshold analysis using survival analysis techniques

  • Colony-forming unit (CFU) comparisons:

    • Log-transformation of CFU data to achieve normal distribution

    • ANOVA with post-hoc tests (Tukey's or Dunnett's) for multiple strain comparisons

    • Non-parametric alternatives (Kruskal-Wallis test) when normality cannot be achieved

For substrate transport assays:

  • Kinetic parameter determination:

    • Michaelis-Menten kinetics analysis to determine Km and Vmax

    • Lineweaver-Burk or Eadie-Hofstee transformations for visualization

    • Non-linear regression fitting for complex kinetic models

  • Inhibition studies:

    • IC50 determination using dose-response curves

    • Ki calculation for competitive inhibitors

    • Mixed-model analysis for complex inhibition patterns

For gene expression studies:

  • RT-qPCR data:

    • ΔΔCt method with appropriate reference genes

    • ANOVA or t-tests for comparing expression levels

    • Correlation analysis between expression and phenotypic outcomes

For in vivo studies:

  • Survival analysis:

    • Kaplan-Meier survival curves with log-rank tests

    • Cox proportional hazards models for covariate analysis

  • Bacterial burden analysis:

    • Log-transformation of organ CFU data

    • ANOVA or non-parametric alternatives

    • Mixed-effects models for repeated measures designs

General statistical considerations:

  • Power analysis:

    • A priori determination of required sample sizes

    • Post-hoc power calculations for negative results

  • Multiple testing correction:

    • Bonferroni correction for conservative approach

    • False Discovery Rate (FDR) methods for large-scale analyses

  • Sample size determination:

    • Based on expected effect sizes from preliminary data

    • Consideration of biological and technical variability

The selection of appropriate statistical methods should be guided by the specific experimental design, the nature of the data, and the research questions being addressed. Consulting with a biostatistician during experimental planning is highly recommended for complex study designs.

How can researchers interpret contradictory results between in vitro and in vivo studies of AaeA function?

Interpreting contradictory results between in vitro and in vivo studies of AaeA function requires systematic analysis of potential factors contributing to these discrepancies. Researchers should consider the following methodological framework:

Sources of contradiction:

  • Environmental differences:

    • In vitro conditions fail to replicate the complex host environment

    • pH, temperature, nutrient availability, and oxygen levels differ significantly

    • Host factors absent in vitro may modulate AaeA function in vivo

  • Bacterial physiological state:

    • Growth phase differences between laboratory cultures and in vivo bacteria

    • Expression levels of AaeA may vary based on environmental cues

    • Compensatory mechanisms may be activated in vivo but not in vitro

  • Host immune interactions:

    • Immune response pressures in vivo can alter bacterial gene expression

    • Neutrophil interactions significantly affect Y. pestis survival

    • Inflammatory mediators may influence efflux pump activity

Reconciliation strategies:

  • Improved in vitro models:

    • Develop culture conditions that better mimic in vivo environments

    • Incorporate relevant host cells in co-culture systems

    • Use ex vivo tissue models that maintain organ architecture

  • Temporal considerations:

    • Perform time-course experiments to capture dynamic changes

    • Analyze AaeA function at different infection stages

    • Consider bacterial adaptation over time in host environments

  • Genetic approaches:

    • Create reporter strains to monitor aaeA expression in vivo

    • Develop inducible expression systems for temporal control

    • Generate point mutations to identify functionally critical residues

  • Mechanistic investigations:

    • Identify specific substrates relevant to in vivo environments

    • Examine post-translational modifications present only in vivo

    • Investigate protein interaction partners in different contexts

Resolution framework:

Contradiction TypeInvestigation ApproachExpected Outcome
AaeA shows efflux activity in vitro but no phenotype in vivoExamine functional redundancy with other efflux systemsIdentification of compensatory mechanisms
AaeA mutants show attenuated virulence without affecting antibiotic resistanceInvestigate non-antibiotic substrates related to virulenceDiscovery of novel virulence-related substrates
AaeA expression differs between in vitro and in vivo conditionsCharacterize regulatory networks controlling expressionIdentification of in vivo-specific regulatory factors
AaeA substrate specificity differs between settingsAnalyze post-translational modifications or conformational changesUnderstanding context-dependent functional alterations

By systematically addressing these potential sources of contradiction, researchers can develop a more nuanced understanding of AaeA function and its context-dependent roles in Y. pestis biology and pathogenesis.

What are the most promising approaches for targeting AaeA in potential therapeutic strategies against Y. pestis infections?

Based on current understanding of efflux pumps and their roles in bacterial pathogenesis, several promising approaches for targeting AaeA in therapeutic strategies against Y. pestis infections can be identified:

Direct inhibition strategies:

  • Small molecule inhibitors:

    • Develop competitive inhibitors that bind the substrate pocket

    • Design allosteric inhibitors that lock the pump in inactive conformations

    • Utilize structure-based drug design if crystal structures become available

  • Peptide inhibitors:

    • Design peptides that disrupt protein-protein interactions within the efflux complex

    • Develop peptidomimetics with improved pharmacokinetic properties

    • Create peptide-drug conjugates for targeted delivery

  • Antibody-based approaches:

    • Generate antibodies against extracellular epitopes of AaeA

    • Develop antibody-drug conjugates for targeted delivery

    • Create bispecific antibodies targeting both AaeA and immune effector cells

Indirect targeting approaches:

  • Gene expression modulators:

    • Identify and target transcriptional regulators of aaeA

    • Develop antisense oligonucleotides to block translation

    • Utilize CRISPR interference technologies to suppress expression

  • Membrane disruptors:

    • Design compounds that alter membrane fluidity, affecting pump assembly

    • Target lipid rafts that may be important for efflux pump function

    • Develop membrane-active peptides that disrupt pump assembly

  • Energy depletion strategies:

    • Target energy sources required for AaeA function

    • Develop uncouplers that specifically affect efflux pumps

    • Create ATP-competitive inhibitors for associated ATPases

Combination approaches:

  • Antibiotic-efflux inhibitor combinations:

    • Pair existing antibiotics with AaeA inhibitors to restore sensitivity

    • Design dual-action molecules combining antibiotic and inhibitor functions

    • Develop nanocarriers that co-deliver antibiotics and inhibitors

  • Multi-target approaches:

    • Simultaneously target multiple efflux systems (AaeA, AcrAB-TolC )

    • Combine efflux inhibition with other antivirulence strategies

    • Target multiple points in efflux pump assembly or function

The efficacy of these approaches would need to be evaluated in appropriate models of Y. pestis infection, with particular attention to the primary pneumonic plague model, which represents a severe and rapidly fatal form of the disease .

How might systems biology approaches enhance our understanding of AaeA's role in the broader context of Y. pestis pathophysiology?

Systems biology approaches offer powerful frameworks for understanding AaeA within the complex network of Y. pestis pathophysiology. These integrative strategies can reveal emergent properties and contextual functions that may not be apparent from reductionist approaches:

Multi-omics integration:

  • Integrative analysis combining:

    • Transcriptomics - to identify co-regulated genes and regulatory networks

    • Proteomics - to map protein-protein interactions and post-translational modifications

    • Metabolomics - to identify substrates and metabolic impacts of AaeA function

    • Fluxomics - to quantify changes in metabolic pathways affected by AaeA

  • Temporal dynamics analysis:

    • Time-resolved multi-omics to capture dynamic changes during infection

    • Identification of key transition points in host-pathogen interactions

    • Correlation of AaeA activity with disease progression milestones

Network analysis approaches:

  • Protein interaction networks:

    • Mapping AaeA's direct interaction partners

    • Identifying hub proteins that connect AaeA to other cellular functions

    • Determining network perturbations caused by AaeA deletion

  • Regulatory network reconstruction:

    • Identifying transcription factors controlling aaeA expression

    • Mapping signal transduction pathways affecting AaeA function

    • Characterizing feedback loops that modulate efflux activity

Computational modeling:

  • Predictive models of AaeA function:

    • Mathematical modeling of substrate transport kinetics

    • Simulation of effects on cellular physiology

    • Integration with whole-cell models of Y. pestis

  • Host-pathogen interaction models:

    • Agent-based modeling of infection dynamics

    • Prediction of evolutionary trajectories under selective pressure

    • Virtual screening of potential inhibitors

In silico approaches:

  • Structural bioinformatics:

    • Homology modeling based on related proteins

    • Molecular dynamics simulations to study conformational changes

    • Virtual screening of compound libraries for inhibitor discovery

  • Comparative genomics:

    • Analysis of AaeA conservation across Yersinia species

    • Identification of species-specific adaptations

    • Evolutionary analysis to identify positively selected residues

The integration of these systems biology approaches would generate a comprehensive understanding of AaeA's contributions to Y. pestis pathophysiology, revealing its connections to virulence networks, stress responses, and metabolic adaptations during infection. This holistic perspective would inform more effective therapeutic strategies against plague by identifying optimal intervention points and potential combination approaches.

What are the key challenges and limitations in current research on Y. pestis AaeA?

Current research on Y. pestis AaeA faces several significant challenges and limitations that impact progress in understanding this efflux pump component. Researchers should consider these limitations when designing studies and interpreting results:

Technical challenges:

  • Membrane protein complexity:

    • Difficulties in expression and purification of functional protein

    • Challenges in crystallization for structural studies

    • Limited stability of the protein outside the membrane environment

  • Biosafety constraints:

    • Y. pestis is a Tier 1 Select Agent requiring BSL-3 facilities

    • Restricted access limits research capacity and collaboration

    • Alternative models may not fully recapitulate native biology

  • Methodological limitations:

    • Lack of specific antibodies or probes for AaeA detection

    • Difficulties in directly measuring efflux activity in vivo

    • Challenges in distinguishing AaeA-specific effects from other efflux systems

Knowledge gaps:

  • Substrate specificity:

    • Incomplete characterization of natural and clinically relevant substrates

    • Limited understanding of substrate binding mechanisms

    • Unknown physiological roles beyond p-hydroxybenzoic acid efflux

  • Regulatory networks:

    • Poor understanding of transcriptional and post-transcriptional regulation

    • Limited knowledge of environmental signals that modulate expression

    • Unknown interactions with global stress response systems

  • Structural information:

    • Absence of high-resolution structures for Y. pestis AaeA

    • Limited understanding of conformational changes during transport

    • Incomplete knowledge of protein-protein interactions within the efflux complex

Translational challenges:

  • Model systems:

    • Animal models may not fully replicate human disease pathophysiology

    • In vitro systems lack the complexity of the host environment

    • Difficulty in studying AaeA in the context of human infection

  • Inhibitor development:

    • Limited chemical scaffolds known to target AaeA

    • Challenges in achieving specificity without affecting host transporters

    • Difficulties in obtaining drug-like properties for membrane protein inhibitors

  • Clinical relevance:

    • Uncertain contribution to antibiotic resistance in clinical settings

    • Unknown relevance to treatment failure or disease progression

    • Ethical constraints on human studies with virulent Y. pestis

Addressing these challenges will require multidisciplinary approaches, including advanced protein engineering, high-throughput screening technologies, and innovative infection models. Future research directions should prioritize resolving these limitations to advance our understanding of AaeA's role in Y. pestis pathogenesis and identify potential therapeutic interventions.

How does understanding AaeA contribute to the broader field of bacterial antibiotic resistance and virulence?

Understanding Y. pestis AaeA contributes significantly to the broader field of bacterial antibiotic resistance and virulence through multiple dimensions of impact:

Conceptual contributions:

  • Evolutionary insights:

    • AaeA represents a conserved mechanism across diverse bacterial species

    • Studying Y. pestis AaeA illuminates how pathogens adapt efflux systems for survival

    • Comparison with homologs provides insight into functional specialization

  • Structure-function relationships:

    • Detailed understanding of AaeA may reveal general principles of efflux pump operation

    • Identification of critical residues advances knowledge of transport mechanisms

    • Structural studies contribute to fundamental membrane protein biology

  • Host-pathogen interaction models:

    • AaeA's role in pathogenesis expands our understanding of bacterial survival strategies

    • Insights into how bacteria modulate efflux in response to host environments

    • Potential discovery of novel virulence-related functions beyond antibiotic resistance

Methodological advancements:

  • Technical innovations:

    • Methods developed for Y. pestis AaeA can be applied to other difficult membrane proteins

    • Assay systems may be adaptable for high-throughput screening platforms

    • Detection methods could translate to diagnostic applications

  • Experimental approaches:

    • Genetic tools created for AaeA studies may be applicable to other bacterial systems

    • Animal models optimized for evaluating efflux pump contributions to pathogenesis

    • Integration of multi-omics approaches provides templates for systems-level analyses

Translational implications:

  • Antimicrobial development:

    • AaeA studies may reveal new targetable vulnerabilities in bacterial defense systems

    • Inhibitors developed for Y. pestis AaeA might have broad-spectrum applications

    • Understanding resistance mechanisms informs antibiotic stewardship strategies

  • Diagnostic potential:

    • AaeA expression patterns might serve as biomarkers for virulence or resistance

    • Detection methods could be incorporated into rapid diagnostics

    • Genetic variations in aaeA might predict treatment response

  • Biotechnology applications:

    • Engineered AaeA could be used for bioremediation of aromatic compounds

    • Expression systems developed for AaeA might benefit industrial enzyme production

    • Substrate specificity insights could inform metabolic engineering projects

By positioning Y. pestis AaeA research within these broader contexts, investigators contribute not only to plague-specific knowledge but also to fundamental understanding of bacterial physiology, antibiotic resistance mechanisms, and host-pathogen interactions. This expansive perspective enhances the impact and applicability of research findings beyond the immediate focus on Y. pestis pathogenesis.

What is a recommended protocol for generating and validating AaeA deletion mutants in Y. pestis?

The following detailed protocol provides a methodological approach for generating and validating AaeA deletion mutants in Y. pestis, incorporating appropriate biosafety considerations and quality control steps:

Protocol for generating ΔaaeA mutants in Y. pestis:

Materials required:

  • Y. pestis wild-type strain (work in BSL-3 facility)

  • Suicide vector (e.g., pCVD442 or pRE112)

  • PCR reagents and high-fidelity polymerase

  • Restriction enzymes and T4 DNA ligase

  • Chemically competent E. coli (SM10λpir for conjugation)

  • Selective antibiotics (ampicillin, polymyxin B)

  • Growth media (Heart Infusion Broth, Congo Red agar)

  • Sucrose (6% for counter-selection)

  • DNA purification kits

  • PCR/sequencing primers

Procedure:

1. Construction of deletion vector:
a. Design primers to amplify ~1000 bp upstream and downstream of aaeA
- Forward upstream primer: include restriction site compatible with suicide vector
- Reverse upstream primer: include 15-20 bp overlap with downstream region
- Forward downstream primer: include 15-20 bp overlap with upstream region
- Reverse downstream primer: include restriction site compatible with suicide vector

b. PCR amplify upstream and downstream fragments

c. Perform overlap extension PCR to generate deletion construct with upstream and downstream regions fused

d. Digest PCR product and suicide vector with appropriate restriction enzymes

e. Ligate digested PCR product into suicide vector

f. Transform into E. coli SM10λpir and select transformants on appropriate antibiotics

g. Verify construct by restriction digestion and sequencing

2. Conjugative transfer to Y. pestis:
a. Grow E. coli SM10λpir containing the suicide vector to mid-log phase

b. Grow Y. pestis wild-type strain to mid-log phase

c. Mix E. coli and Y. pestis cultures at 1:2 ratio

d. Spot 100 μL onto Heart Infusion Agar plate and incubate at 28°C for 6 hours

e. Recover bacteria and plate on selective media containing ampicillin (to select for plasmid) and polymyxin B (to counter-select E. coli)

f. Incubate at 28°C for 48 hours

3. Selection of deletion mutants:
a. Pick single colonies and grow in non-selective media overnight

b. Plate serial dilutions on media containing 6% sucrose (counter-selection for sacB)

c. Screen sucrose-resistant colonies for ampicillin sensitivity (indicating loss of plasmid)

d. Verify deletion by colony PCR using primers flanking the deletion site

4. Validation of ΔaaeA mutants:

Genetic validation:
a. Whole-genome sequencing to confirm deletion and absence of secondary mutations

b. RT-qPCR to verify absence of aaeA transcript

c. Western blotting (if antibodies available) to confirm absence of AaeA protein

Phenotypic validation:
a. Growth curve analysis to assess impact on bacterial fitness

b. Antibiotic susceptibility testing (determine MICs for multiple antibiotics)

c. Substrate accumulation assays using fluorescent dyes known to be efflux substrates

Complementation:
a. Clone wild-type aaeA gene into an expression vector with native promoter

b. Introduce the complementation construct into the ΔaaeA mutant

c. Verify expression of AaeA in the complemented strain

d. Confirm restoration of wild-type phenotypes

5. Functional characterization:
a. Compare wild-type, ΔaaeA, and complemented strains in:
- Growth under various stress conditions
- Antibiotic resistance profiles
- In vitro infection models
- In vivo virulence in animal models

This comprehensive protocol ensures the generation of genetically clean AaeA deletion mutants with appropriate controls for subsequent functional studies. The inclusion of complementation experiments is critical for confirming that observed phenotypes are specifically due to the absence of AaeA rather than polar effects or secondary mutations.

What are the essential skills and knowledge researchers need to acquire before working with Y. pestis AaeA?

Researchers planning to work with Y. pestis AaeA should acquire a comprehensive set of skills and knowledge spanning multiple disciplines. This interdisciplinary preparation is essential for conducting safe, rigorous, and productive research:

Biosafety and regulatory knowledge:

  • BSL-3 training and certification:

    • Proper use of personal protective equipment

    • Aerosol containment procedures

    • Emergency response protocols

    • Decontamination methods

  • Select Agent regulations:

    • Federal regulations for possession, use, and transfer

    • Institutional biosafety committee requirements

    • Proper documentation and record-keeping

    • Security clearance requirements

  • Risk assessment skills:

    • Identification of experiment-specific risks

    • Development of risk mitigation strategies

    • Recognition of symptoms of Y. pestis exposure

Technical competencies:

  • Molecular biology techniques:

    • PCR and qPCR for gene amplification and expression analysis

    • Cloning methods for construct generation

    • Site-directed mutagenesis for functional studies

    • DNA sequencing analysis

  • Microbiology skills:

    • Aseptic technique and bacterial culture methods

    • Antimicrobial susceptibility testing

    • Bacterial transformation and conjugation

    • Biofilm formation assays

  • Protein biochemistry:

    • Membrane protein expression and purification

    • Detergent solubilization methods

    • Protein activity assays

    • Western blotting and immunoprecipitation

  • Advanced methodologies:

    • Fluorescence-based transport assays

    • Flow cytometry for bacterial analysis

    • Microscopy techniques for localization studies

    • Animal handling and infection models

Theoretical knowledge:

  • Bacterial physiology:

    • Membrane biology and transport mechanisms

    • Stress response systems

    • Antibiotic resistance mechanisms

    • Bacterial adaptation to host environments

  • Y. pestis-specific knowledge:

    • Life cycle and transmission routes

    • Virulence factors and pathogenesis

    • Genetic manipulation systems

    • Host-pathogen interactions

  • Efflux pump biology:

    • Structural organization of efflux systems

    • Substrate specificity determinants

    • Energetics of transport

    • Regulatory mechanisms

Data analysis capabilities:

  • Bioinformatics skills:

    • Sequence analysis and alignment

    • Homology modeling

    • Gene expression data analysis

    • Comparative genomics

  • Statistical analysis:

    • Experimental design principles

    • Appropriate statistical methods

    • Data visualization techniques

    • Power analysis for sample size determination

Collaborative abilities:

  • Interdisciplinary communication:

    • Ability to discuss research with specialists from diverse fields

    • Clear presentation of complex data

    • Effective scientific writing

  • Ethical considerations:

    • Responsible research conduct

    • Dual-use research of concern awareness

    • Ethical implications of working with dangerous pathogens

This multifaceted skill set provides the foundation for safe, methodologically sound, and scientifically rigorous research on Y. pestis AaeA. Researchers should pursue specialized training in areas particularly relevant to their specific research questions and approaches.

What are the most important primary research papers and review articles for researchers beginning work on Y. pestis AaeA?

For researchers beginning work on Y. pestis AaeA, a carefully curated collection of primary research papers and review articles is essential for building foundational knowledge. While the search results provided limited direct studies on Y. pestis AaeA specifically, the following recommended literature would provide critical context and methodological guidance:

Foundational studies on bacterial efflux systems:

  • Studies on the AcrAB-TolC system in Y. pestis mentioned in search result , which highlight the role of efflux pumps in antibiotic resistance and virulence

  • Research on related efflux systems in Enterobacteriaceae, including the E. coli AaeA protein described in search result

  • Mechanistic studies on p-hydroxybenzoic acid efflux in related bacterial species

Y. pestis pathogenesis research:

  • The study on Y. pestis BipA and its role in pneumonic plague pathogenesis , which provides an excellent framework for studying virulence factors

  • Research on Y. pestis-host interactions, particularly with neutrophils

  • Studies on bacterial survival mechanisms in the lung during primary pneumonic plague

Methodological papers:

  • Protocols for recombinant protein expression and purification, particularly for membrane proteins like AaeA

  • Genetic manipulation techniques for Y. pestis

  • Functional assays for measuring efflux pump activity

Review articles:

  • Comprehensive reviews on bacterial efflux systems and their roles in antibiotic resistance

  • Reviews on Y. pestis virulence mechanisms and host interaction

  • Articles on plague pathogenesis and treatment challenges

Technical resources:

  • Structural biology approaches for membrane protein analysis

  • Systems biology methods for studying bacterial pathogens

  • In vivo imaging techniques for tracking bacterial infections

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.