Recombinant Yersinia pestis bv. Antiqua Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE (arnE)

Shipped with Ice Packs
In Stock

Description

Introduction to Yersinia pestis and ArnE

Yersinia pestis is the causative agent of plague, one of history's most devastating pandemics, including the Plague of Justinian and the Black Death . This gram-negative, non-motile, coccobacillus bacterium causes three main forms of plague: pneumonic, septicemic, and bubonic . The bacterium's lifecycle critically depends on its ability to survive within flea vectors before transmission to mammalian hosts.

The ArnE protein represents a crucial component of Y. pestis' defense mechanisms against host immune responses. As a subunit of the 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase, ArnE participates in the process of lipopolysaccharide (LPS) modification, particularly of lipid A . This modification involves the addition of 4-amino-4-deoxy-L-arabinose (Ara4N) to lipid A, which alters the bacterial surface charge and enhances resistance to cationic antimicrobial peptides (CAMPs) .

Research has demonstrated that proteins involved in Ara4N modification of lipid A are essential for Y. pestis maintenance in fleas during the early-phase transmission (EPT) period, which occurs shortly after flea infection . This underscores the significance of ArnE in the bacteria's transmission cycle and pathogenesis.

Biological Function and Significance

ArnE serves a critical role in Y. pestis pathogenicity through its participation in LPS modification mechanisms. As a component of the flippase complex, it facilitates the translocation of Ara4N-modified lipid precursors from the cytoplasmic to the periplasmic face of the bacterial inner membrane, where they can be incorporated into lipid A structures .

Signature-tagged mutagenesis (STM) studies have identified that mutations in the arn operon genes, particularly arnB, significantly reduce Y. pestis fitness in fleas and increase susceptibility to CAMPs such as cecropin A and polymyxin B . Although the research focuses primarily on arnB rather than arnE specifically, the functional relationship between these components suggests that ArnE is similarly crucial for the bacteria's survival strategy.

The modification of lipid A with Ara4N alters the surface charge of the bacterial outer membrane, reducing the binding affinity of positively charged antimicrobial peptides produced by the host immune system . This molecular mechanism represents an essential adaptation that enables Y. pestis to survive within the flea gut environment, where it would otherwise be vulnerable to these innate immune defense molecules.

Research has demonstrated that Y. pestis mutants lacking functional arn operon components produce lipid A structures that lack Ara4N modifications, making them more susceptible to host defense peptides and significantly impairing their ability to maintain infection in the flea vector . This highlights the importance of the entire Ara4N modification system, including the ArnE flippase subunit, in plague transmission dynamics.

Production of Recombinant ArnE

The recombinant form of Y. pestis bv. Antiqua ArnE protein is produced using E. coli expression systems . This approach allows for controlled production of the protein for research applications, enabling studies of its structure, function, and potential as a therapeutic target.

The production process typically involves:

  1. Cloning of the partial or complete arnE gene into an appropriate expression vector

  2. Transformation into E. coli host cells

  3. Induction of protein expression under optimized conditions

  4. Harvesting and lysis of bacterial cultures

  5. Purification of the recombinant protein using affinity chromatography

  6. Quality control assessment, including purity determination via SDS-PAGE

The commercially available recombinant protein achieves a purity of >85% as determined by SDS-PAGE analysis . This level of purity is sufficient for most research applications, including structural studies, functional assays, and immunological investigations.

The recombinant protein may include various tags to facilitate purification and detection, though the specific tag type is determined during the manufacturing process and may vary between production batches .

Research Applications and Significance

The recombinant Y. pestis ArnE protein serves as a valuable tool for multiple research applications related to bacterial pathogenesis and antimicrobial resistance mechanisms.

Antimicrobial Resistance Mechanisms

Studies involving recombinant ArnE contribute to our understanding of how gram-negative bacteria develop resistance to cationic antimicrobial peptides. Since the Ara4N modification system represents a conserved mechanism across multiple bacterial pathogens, insights gained from Y. pestis ArnE research have broader implications for combating antimicrobial resistance.

Therapeutic Target Development

The essential role of ArnE in Y. pestis survival within flea vectors makes it a potential target for novel antimicrobial strategies aimed at disrupting plague transmission. Researchers can use the recombinant protein for high-throughput screening of compound libraries to identify potential inhibitors of the flippase function.

Immunological Investigations

The recombinant protein can serve as an antigen for antibody production or in immunological assays designed to detect immune responses to Y. pestis infection. This application is valuable for both diagnostic development and vaccine research.

Relationship to Plague Transmission

The significance of ArnE in Y. pestis pathogenesis is particularly evident in the context of flea-borne transmission. Y. pestis can be transmitted by fleas through two distinct mechanisms: early-phase transmission (EPT), which occurs shortly after flea infection, and blocked flea transmission, which follows long-term infection .

Signature-tagged mutagenesis studies have identified that components of the Ara4N modification system, including genes in the same operon as arnE, are critical for Y. pestis maintenance in the flea vector Xenopsylla cheopis during the initial 4-day period corresponding to EPT . This finding underscores the importance of lipid A modification in the early stages of flea infection.

The modification of lipid A with Ara4N appears to protect Y. pestis from the bactericidal effects of CAMPs present in the flea gut environment . Without these protective modifications, the bacteria exhibit significantly reduced fitness and are less likely to establish the infection necessary for transmission to mammalian hosts.

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement in the order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timeframe.
All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
arnE; YpAngola_A2607; Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE; L-Ara4N-phosphoundecaprenol flippase subunit ArnE; Undecaprenyl phosphate-aminoarabinose flippase subunit ArnE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-114
Protein Length
full length protein
Species
Yersinia pestis bv. Antiqua (strain Angola)
Target Names
arnE
Target Protein Sequence
MNSYLLLLMVSLLTCIGQLCQKQAAQCWEQPQARRLNLTLRWLAIAVVSLGLGMLLWLRL LQQLPLSVAYPMLSFNFVLVTLAAQLFYGEKATLRHWLGVAAIMFGILLMSWHL
Uniprot No.

Target Background

Function
This protein functions as a translocator, moving 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (alpha-L-Ara4N-phosphoundecaprenol) across the inner membrane from the cytoplasm to the periplasmic side.
Database Links
Protein Families
ArnE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Yersinia pestis biovar Antiqua and how does it differ from other Y. pestis strains?

Yersinia pestis biovar Antiqua represents one of the classical biovars of the plague bacterium. Despite belonging to the same biovar classification, genomic analyses have revealed that strains like Antiqua and Nepal516 represent separate evolutionary lineages. The Antiqua strain has a chromosome size of 4,702,289 bp with 4,138 coding sequences and a G+C content of 47.70% .

Comparative genomic studies have identified 453 single nucleotide polymorphisms (SNPs) in protein-coding regions that help establish evolutionary relationships between Y. pestis strains . The genome of Y. pestis Antiqua also contains several plasmids with distinct characteristics:

CharacteristicAntiquaNepal516
Chromosome size (bp)4,702,2894,534,590
G+C content (%)47.7047.58
Coding sequences4,1383,956
Average gene length (bp)953958
Coding density (%)83.883.6
pMT size (bp)96,471100,918
pCD size (bp)70,299
pPCP size (bp)10,77710,778

These genomic differences reflect the selective pressures acting on Y. pestis throughout its evolution and adaptation to different hosts .

What is the probable function of the ArnE protein in Y. pestis pathogenesis?

The ArnE protein in Y. pestis likely functions as a subunit of the 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase, which is part of the lipopolysaccharide (LPS) modification system. While specific information on Y. pestis ArnE is limited in the available literature, research on similar proteins in other Gram-negative bacteria suggests this enzyme plays a critical role in antimicrobial resistance and host adaptation .

The Arn system modifies lipid A with 4-amino-4-deoxy-L-arabinose (L-Ara4N), reducing the negative charge of the bacterial outer membrane. This modification decreases binding of cationic antimicrobial peptides and certain antibiotics, potentially contributing to Y. pestis survival during infection. Given that Y. pestis must adapt to temperature shifts during transition from flea vectors to mammalian hosts, this membrane modification system likely plays an important role in pathogen adaptation .

How does Y. pestis adapt to different host environments during infection?

Y. pestis employs sophisticated mechanisms to adapt to diverse host environments. During transmission from fleas to mammals, the bacterium must rapidly adjust to temperature shifts, nutrient availability, and host immune responses . Key adaptive mechanisms include:

  • Temperature-responsive gene regulation that facilitates the transition between flea (lower temperature) and mammalian host (higher temperature) environments

  • Counteraction of host biometal sequestration through multiple metal acquisition systems:

    • Iron acquisition via yersiniabactin (Ybt) siderophore and iron transporters Yfe and Feo

    • Zinc acquisition through ZnuABC transporter and Ybt siderophore

    • Manganese acquisition via Yfe and MntH transporters

  • Complex immunomodulation strategies that suppress host immune responses, allowing for heavy bacterial growth in host blood, facilitating subsequent flea transmission

These adaptive mechanisms enable Y. pestis to successfully navigate its mammal-flea-mammal life cycle, contributing to its effectiveness as a pathogen.

What expression systems are most effective for producing recombinant Y. pestis proteins for structural and functional studies?

Several expression systems have proven effective for producing recombinant Y. pestis proteins, each with specific advantages depending on research objectives:

  • Plant-based expression systems: Transient expression in Nicotiana benthamiana using a deconstructed tobacco mosaic virus-based system has demonstrated "very rapid and extremely high levels of expression" for Y. pestis antigens F1, V, and F1-V fusion protein . This approach may be particularly valuable for vaccine development purposes.

  • E. coli expression systems: The Y. pestis V antigen has been successfully expressed in E. coli as an N-terminal GST fusion protein, followed by GST capture and subsequent thrombin elution . This represents a more traditional approach that may be suitable for initial structural studies.

For membrane-associated proteins like ArnE, specialized expression systems designed for membrane proteins may be necessary. When selecting an expression system for ArnE, researchers should consider the protein's subcellular localization, post-translational modifications, and requirements for proper folding and assembly into multiprotein complexes.

How does protein structure influence the immunogenicity of Y. pestis antigens, and what implications might this have for ArnE?

Protein structure significantly impacts the immunogenicity of Y. pestis antigens. Research on the F1 antigen has demonstrated that its quaternary structure is critical for inducing protective immunity. While mice immunized with either monomeric or multimeric recombinant F1 (rF1) develop similar immune responses, those immunized with multimeric rF1 showed significantly better protection against Y. pestis challenge (5/7 protected) compared to those receiving monomeric rF1 (1/7 protected) .

The rF1 antigen exists naturally as a high molecular mass multimer that dissociates after heating in the presence of SDS and reassociates upon SDS removal . This structural characteristic appears crucial for its protective capacity.

For ArnE protein studies, these findings suggest that maintaining native protein conformation and oligomeric state may be essential for accurately assessing its immunological properties. Researchers should employ structural characterization methods such as circular dichroism and gel filtration chromatography to verify proper folding and assembly of recombinant ArnE preparations.

What role might the ArnE protein play in antimicrobial resistance mechanisms of Y. pestis?

As a probable component of the 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase complex, ArnE likely contributes to Y. pestis antimicrobial resistance through LPS modification. This system facilitates the addition of L-Ara4N to lipid A, which reduces the negative charge of the bacterial outer membrane, thereby decreasing binding affinity for cationic antimicrobial peptides and certain antibiotics like polymyxins.

Y. pestis must overcome host defense mechanisms including antimicrobial peptides during early infection stages and throughout its presence in blood and tissues . The modification of LPS structure through ArnE and related proteins may represent an important strategy for evading these innate immune defenses.

The emergence of antibiotic-resistant Y. pestis strains has been noted as a concern in the context of biological warfare preparedness . Understanding the molecular mechanisms of resistance, including the role of ArnE in membrane modification, could be crucial for developing countermeasures against resistant strains.

What purification strategies would be most effective for isolating functional recombinant ArnE protein?

Based on successful purification approaches for other Y. pestis proteins, the following strategies may be effective for ArnE purification:

  • Affinity tag purification: Expression of ArnE as a fusion protein with tags such as GST, as demonstrated for Y. pestis V antigen , followed by affinity chromatography and tag removal by protease cleavage.

  • Sequential chromatography: A multi-step purification approach similar to that used for rF1 antigen, involving ammonium sulfate fractionation followed by FPLC Superose gel filtration chromatography .

For membrane proteins like ArnE, additional considerations include:

  • Detergent selection: Careful screening of detergents for solubilization that maintain protein structure and function

  • Lipid reconstitution: Following purification, reconstitution into lipid bilayers or nanodiscs may be necessary to study function

  • Quality control: Verification of proper folding and oligomeric state using techniques such as circular dichroism and size exclusion chromatography

The purification strategy should be optimized based on the specific experimental objectives, whether structural characterization, functional analysis, or immunological studies.

How can researchers effectively evaluate the function of ArnE in lipid A modification and antimicrobial resistance?

To assess ArnE function in lipid A modification and antimicrobial resistance, researchers could employ the following experimental approaches:

  • Genetic manipulation studies:

    • Creation of arnE deletion mutants in Y. pestis

    • Complementation with wild-type and site-directed mutants

    • Assessment of lipid A structure in these strains using mass spectrometry

  • Functional assays:

    • Antimicrobial peptide and polymyxin susceptibility testing

    • Membrane permeability assays

    • In vitro flippase activity assays using fluorescently labeled lipid substrates

  • Structural analysis:

    • Mass spectrometric analysis of lipid A from wild-type and arnE mutant strains

    • Quantification of L-Ara4N modification under various growth conditions

    • Correlation of structural changes with resistance phenotypes

  • In vivo relevance:

    • Assessment of arnE mutant virulence in animal models

    • Determination of survival in presence of host defense peptides

    • Evaluation of impact on flea-mammal transmission cycle

These approaches would provide complementary data on ArnE function and its contribution to Y. pestis pathogenesis and antimicrobial resistance.

What methodological approaches would best elucidate the structural characteristics of the ArnE protein?

To determine the structural characteristics of ArnE protein, researchers should consider employing multiple complementary techniques:

  • Biophysical characterization:

    • Circular dichroism spectroscopy to assess secondary structure content and thermal stability

    • Size exclusion chromatography to determine oligomeric state and homogeneity

    • Analytical ultracentrifugation for precise molecular weight determination

  • Structural determination:

    • X-ray crystallography of purified protein (potentially challenging for membrane proteins)

    • Cryo-electron microscopy for larger assemblies or membrane-embedded complexes

    • NMR spectroscopy for dynamic regions and ligand interactions

  • Computational approaches:

    • Homology modeling based on related proteins with known structures

    • Molecular dynamics simulations to predict conformational changes

    • Protein-lipid interaction modeling

  • Functional structure analysis:

    • Site-directed mutagenesis of predicted functional residues

    • Cross-linking studies to map protein-protein interactions

    • Hydrogen-deuterium exchange mass spectrometry to identify flexible regions

Integration of these approaches would provide comprehensive structural insights into ArnE, informing functional studies and potentially facilitating targeted drug design efforts.

How should researchers analyze genomic variations in the arnE gene across Y. pestis strains?

Analysis of genomic variations in the arnE gene should employ systematic comparative approaches:

  • Sequence alignment and SNP identification:

    • Multiple sequence alignment of arnE from different Y. pestis strains and biovars

    • Identification of SNPs in coding regions, similar to the approach that identified 453 SNPs across Y. pestis strains

    • Determination whether variations result in synonymous or non-synonymous changes

  • Evolutionary analysis:

    • Phylogenetic tree construction based on arnE sequence variations

    • Calculation of selection pressure (Ka/Ks ratio) to determine if arnE is under positive, neutral, or purifying selection

    • Comparison with evolutionary patterns of other Y. pestis genes

  • Structure-function correlation:

    • Mapping identified variations onto predicted protein structures

    • Assessment of conservation patterns in functional domains

    • Correlation of specific variants with antimicrobial resistance phenotypes

  • Comparative genomics:

    • Analysis of arnE in Y. pestis versus the ancestral Y. pseudotuberculosis

    • Examination of gene neighborhood conservation across strains

    • Investigation of horizontal gene transfer evidence

This comprehensive analysis would provide insights into the evolutionary significance of arnE and its potential role in Y. pestis adaptation to different environments.

What challenges might researchers encounter when studying interactions between the ArnE protein and other components of the LPS modification pathway?

Researchers investigating ArnE interactions face several significant challenges:

  • Membrane protein complexes:

    • Difficulty in maintaining native interactions during purification

    • Challenges in reconstituting multi-protein complexes in vitro

    • Limited availability of structural techniques for membrane protein assemblies

  • Transient interactions:

    • ArnE likely participates in dynamic interactions with other Arn proteins and lipid substrates

    • Capturing these transient interactions requires specialized techniques

    • Distinguishing specific from non-specific interactions in detergent-solubilized systems

  • Functional redundancy:

    • Potential overlapping functions with other membrane modification systems

    • Challenges in isolating the specific contribution of ArnE

    • Compensatory mechanisms that may mask phenotypes in single gene deletions

  • Technical limitations:

    • Difficulty in tracking lipid flipping across membranes in real-time

    • Challenges in reconstituting the complete LPS modification pathway in vitro

    • Limited availability of specific antibodies or probes for ArnE and its substrates

To overcome these challenges, researchers should consider integrated approaches combining genetic, biochemical, and structural methods, potentially including new techniques such as proximity labeling and single-molecule tracking.

How can contradictory findings regarding ArnE function be reconciled in the context of Y. pestis pathogenesis?

When faced with contradictory findings regarding ArnE function, researchers should employ these strategies for reconciliation:

  • Experimental context consideration:

    • Evaluate differences in strain backgrounds used across studies

    • Assess variations in growth conditions and their impact on gene expression

    • Consider the influence of different animal models or infection routes

  • Methodological differences analysis:

    • Compare sensitivity and specificity of different analytical techniques

    • Assess the impact of protein tags or fusion partners on function

    • Evaluate whether in vitro findings translate to in vivo conditions

  • Integrative approaches:

    • Combine multiple experimental methodologies to build consensus

    • Use systems biology approaches to place contradictory findings in broader context

    • Develop mathematical models to reconcile seemingly disparate observations

  • Strain-specific effects:

    • Investigate whether contradictions reflect genuine biological differences between Y. pestis strains

    • Determine if specific genetic backgrounds influence ArnE function

    • Assess the impact of other genetic factors on ArnE-dependent phenotypes

By carefully analyzing experimental contexts and employing complementary approaches, researchers can develop a more complete understanding of ArnE function in Y. pestis pathogenesis, potentially reconciling apparently contradictory findings.

What are the most promising future research directions for understanding ArnE in Y. pestis bv. Antiqua?

Future research on ArnE in Y. pestis bv. Antiqua should focus on several key areas:

  • Structure-function relationships:

    • Determination of high-resolution structures of ArnE alone and in complex with interaction partners

    • Elucidation of the molecular mechanism of lipid flipping across membranes

    • Identification of specific residues critical for function through targeted mutagenesis

  • Role in host-pathogen interactions:

    • Investigation of ArnE contribution to survival in different host environments

    • Assessment of impact on interactions with host immune components

    • Evaluation of role during different stages of infection and transmission

  • Antimicrobial resistance:

    • Characterization of ArnE contribution to resistance against host antimicrobial peptides

    • Development of inhibitors targeting ArnE as potential therapeutics

    • Investigation of regulatory networks controlling arnE expression during infection

  • Comparative studies:

    • Analysis of functional differences between ArnE in Y. pestis bv. Antiqua versus other biovars

    • Investigation of evolutionary adaptations in ArnE that contributed to Y. pestis emergence

    • Examination of ArnE function in related Yersinia species

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.