Recombinant Yersinia pestis bv. Antiqua Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF)

Shipped with Ice Packs
In Stock

Description

Functional Role in Bacterial Resistance

ArnF functions as a flippase, translocating L-Ara4N-phosphoundecaprenol from the cytoplasmic to periplasmic membrane leaflet. This modification neutralizes the negative charge of lipid A, reducing cationic antimicrobial peptide (CAMP) binding and enhancing resistance to polymyxins . Key mechanisms include:

  • Operon Synergy: Collaborates with ArnB (aminotransferase) and ArnC (transferase) to synthesize and integrate L-Ara4N into lipopolysaccharides .

  • Pathogen Survival: Critical for Y. pestis evasion of innate immune defenses in mammalian hosts .

Genomic and Evolutionary Context

Comparative genomics of Y. pestis strains (Antiqua, Nepal516) highlights:

  • Gene Reduction: The arn operon is retained in virulent strains, suggesting selective pressure for lipid A modification .

  • Biovar-Specific Variations: Strain Antiqua’s ArnF shares 98% identity with Nepal516 but differs from nonclassical biovars (e.g., microtus) .

Research Applications

Recombinant ArnF is utilized in:

  • Antimicrobial Resistance Studies: Screening inhibitors targeting lipid A modification pathways .

  • Structural Biology: Characterizing flippase mechanisms via cryo-EM or X-ray crystallography .

  • Vaccine Development: Investigating lipid A as a virulence factor .

Challenges and Future Directions

  • Functional Redundancy: Overlap with ArnE complicates in vivo knockout studies .

  • Therapeutic Targeting: High sequence conservation across Enterobacteriaceae makes ArnF a broad-spectrum target .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery estimates.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice packaging, please communicate with us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type preferences, please communicate them to us. We will prioritize the development of your specified tag whenever possible.
Synonyms
arnF; YPA_1760; Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF; L-Ara4N-phosphoundecaprenol flippase subunit ArnF; Undecaprenyl phosphate-aminoarabinose flippase subunit ArnF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Yersinia pestis bv. Antiqua (strain Antiqua)
Target Names
arnF
Target Protein Sequence
MKGYLWGGASVVLVTVAQLVLKWGMMNIPLLSLADINVQFLTMYFVQLASVMCGLMGYAL SMLCWFFALRYLPLNRAYPLLSLSYALVYLGAVLLPWFNEPATLLKTLGAGFILLGIWLI NIKPIKAS
Uniprot No.

Target Background

Function
Facilitates the translocation of 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (alpha-L-Ara4N-phosphoundecaprenol) from the cytoplasmic to the periplasmic side of the inner membrane.
Database Links

KEGG: ypa:YPA_1760

Protein Families
ArnF family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of arnF in Yersinia pestis?

ArnF functions as a subunit of the flippase complex responsible for translocating 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (Ara4N-P-undecaprenol) from the cytoplasmic to the periplasmic face of the inner membrane. This process is critical for the subsequent incorporation of Ara4N into lipid A, a component of the bacterial lipopolysaccharide (LPS). The modification alters the net charge of the bacterial outer membrane, reducing the binding affinity of cationic antimicrobial peptides and contributing to antimicrobial resistance .

To study this function, researchers typically employ gene deletion mutants of arnF or the entire aminoarabinose operon, followed by complementation studies with recombinant arnF to confirm phenotypic restoration. Membrane fractionation and protein localization studies using fluorescent tags or epitope-tagged versions of ArnF can help determine its subcellular localization and interaction partners.

How does the arnF gene fit into the aminoarabinose operon structure?

The arnF gene is part of the aminoarabinose (arn) operon, which typically contains multiple genes involved in the synthesis and transfer of Ara4N to lipid A. In Y. pestis, the operon includes genes responsible for:

  • Synthesis of UDP-Ara4N from UDP-glucuronic acid

  • Transfer of Ara4N to undecaprenyl phosphate

  • Flipping of Ara4N-undecaprenyl phosphate across the inner membrane (involving arnF)

  • Transfer of Ara4N to lipid A

Research approaches to study operon structure typically involve:

  • Transcriptional analysis using RT-PCR or RNA-Seq to determine co-transcription

  • Promoter mapping using 5' RACE or primer extension

  • Identification of regulatory elements through DNase footprinting or chromatin immunoprecipitation

What phenotypic changes are observed when arnF is deleted in Y. pestis?

Deletion of arnF or disruption of the aminoarabinose operon renders Y. pestis highly susceptible to cationic antimicrobial peptides, including the cecropin-class peptide "cheopin" from the flea vector Xenopsylla cheopis. The phenotypic changes include:

  • Increased binding of antimicrobial peptides to the bacterial surface

  • Enhanced membrane permeabilization

  • Reduced survival in the presence of antimicrobial peptides

  • Potential attenuation in flea vectors and mammalian hosts

To demonstrate these phenotypes, researchers typically perform:

  • Minimum inhibitory concentration (MIC) assays with various antimicrobial peptides

  • Fluorescence-based membrane permeability assays

  • Peptide binding assays using fluorescently labeled peptides

  • Confocal microscopy to visualize peptide-bacteria interactions

How do the structural elements of ArnF contribute to its flippase function?

The ArnF protein contains multiple transmembrane domains that form a channel through which Ara4N-phosphoundecaprenol can be translocated. Key structural elements include:

Domain/FeaturePositionProposed Function
Transmembrane helicesVariesFormation of translocation pore
Cytoplasmic loopsBetween TM domainsSubstrate recognition
Periplasmic loopsBetween TM domainsInteraction with other Arn proteins
Conserved charged residuesVarious positionsCatalytic activity or substrate binding

Research approaches to study structure-function relationships include:

  • Site-directed mutagenesis of conserved residues

  • Domain swapping with homologous proteins

  • Protein crystallography or cryo-EM for structural determination

  • Molecular dynamics simulations to predict substrate interactions and translocation mechanisms

What is the relationship between ArnF activity and Y. pestis virulence in different host environments?

Y. pestis encounters diverse host environments, including the flea vector and mammalian hosts. The activity of ArnF and the resulting Ara4N modification appear to play different roles in these environments:

  • In the flea vector: Ara4N modification provides resistance against the antimicrobial peptide "cheopin" and potentially other flea-derived antimicrobial peptides, facilitating bacterial survival and transmission .

  • In mammalian hosts: The role is more complex, potentially involving:

    • Resistance to host antimicrobial peptides

    • Modulation of host immune recognition through altered LPS structure

    • Potential effects on bacterial physiology impacting virulence gene expression

Research methodologies to investigate these relationships include:

  • Flea infection models with wild-type and arnF mutant strains

  • Mouse infection models via different routes (subcutaneous, intranasal, etc.)

  • Transcriptomic analysis of bacteria in different host environments

  • Immune response profiling in infected hosts

How do environmental signals regulate arnF expression and Ara4N modification?

The expression of arnF and other genes in the aminoarabinose operon is regulated by various environmental conditions that Y. pestis encounters during its life cycle. Understanding this regulation is critical for interpreting the role of ArnF in different contexts.

Key regulatory factors include:

Environmental SignalEffect on arnF ExpressionExperimental Approach
Temperature (flea vs. mammalian)Differentially regulatedqRT-PCR at different temperatures
pH changesMay increase at acidic pHGene reporter assays in varying pH
Divalent cation concentrationIncreased in low Mg²⁺ or Ca²⁺Transcriptomics in defined media
Antimicrobial peptide exposurePotential inductionRNA-Seq after sub-lethal AMP exposure
Two-component systemsPhoP/PhoQ, PmrA/PmrB regulationEpistasis analysis with regulatory mutants

To study these regulatory mechanisms, researchers should consider:

  • Construction of transcriptional/translational reporter fusions

  • Chromatin immunoprecipitation to identify transcription factor binding sites

  • Systematic mutagenesis of promoter regions

  • Phosphoproteomic analysis to track signaling cascades

What are the optimal conditions for expressing recombinant ArnF protein?

Expressing functional recombinant ArnF presents challenges due to its multiple transmembrane domains. Researchers should consider:

  • Expression systems:

    • E. coli BL21(DE3) with tightly controlled inducible promoters

    • Cell-free expression systems for direct incorporation into liposomes

    • Yeast expression systems for eukaryotic membrane protein production

  • Optimization parameters:

ParameterRecommendationRationale
Induction temperature16-20°CReduces inclusion body formation
Inducer concentration0.1-0.5 mM IPTGBalances expression and toxicity
Expression time4-16 hoursAllows proper membrane insertion
Media supplements1% glucose, osmolytesStabilizes membranes, reduces toxicity
  • Fusion tags for purification and detection:

    • C-terminal His₆ or His₁₀ tags

    • N-terminal MBP fusion (if terminal is predicted to be cytoplasmic)

    • Fluorescent protein fusions for localization studies

  • Detergent screening for solubilization:

    • Mild detergents (DDM, LMNG) for initial extraction

    • Validation of functional state after solubilization

How can the interaction between ArnF and other proteins in the Ara4N modification pathway be studied?

Understanding protein-protein interactions within the Ara4N modification pathway is essential for elucidating the complete mechanism. Approaches include:

  • Bacterial two-hybrid or split-ubiquitin systems for membrane protein interactions

  • Co-immunoprecipitation with cross-linking to stabilize transient interactions

  • Förster resonance energy transfer (FRET) with fluorescently tagged proteins

  • Mass spectrometry-based interactomics after gentle solubilization

  • Genetic approaches:

    • Synthetic lethality screening

    • Suppressor mutation analysis

    • Site-specific cross-linking with unnatural amino acids

To validate functionally significant interactions, researchers should perform:

  • Mutagenesis of putative interaction interfaces

  • Competition assays with peptide mimics of interaction domains

  • Reconstitution of protein complexes in liposomes or nanodiscs

  • Functional assays measuring Ara4N transfer or antimicrobial peptide resistance

What methods are most effective for measuring Ara4N modification levels in Y. pestis?

Quantitative assessment of Ara4N modification is crucial for correlating ArnF activity with antimicrobial peptide resistance. Methods include:

  • Mass spectrometry analysis of purified LPS:

    • Electrospray ionization (ESI-MS) for intact lipid A analysis

    • MALDI-TOF for rapid screening

    • Tandem MS/MS for structural confirmation

  • Chromatographic approaches:

    • HPLC separation of differently modified lipid A species

    • TLC for comparative analysis across strains

  • Specialized techniques:

    • NMR spectroscopy for detailed structural analysis

    • Immunological detection using Ara4N-specific antibodies

    • Radiolabeling studies with ³²P-phosphate

  • Indirect assays:

    • Polymyxin B binding as a surrogate for Ara4N modification

    • Antimicrobial peptide susceptibility testing

    • Zeta potential measurements of bacterial surface charge

When presenting Ara4N modification data, researchers should include:

  • Complete chemical structures of detected lipid A species

  • Quantitative comparison across different strains and conditions

  • Correlation with functional phenotypes (antimicrobial peptide resistance)

How should experiments be designed to distinguish the specific role of ArnF from other components of the Ara4N modification pathway?

To delineate the specific contribution of ArnF within the Ara4N modification pathway, consider:

  • Genetic complementation strategy:

    • Single-gene deletion (ΔarnF) versus operon deletion

    • Trans-complementation with arnF under native or inducible promoters

    • Point mutations in functional domains versus complete deletion

  • Sequential enzyme assays:

    • In vitro reconstitution of individual steps

    • Isolation of reaction intermediates

    • Utilization of substrate analogs to trap specific states

  • Epistasis analysis:

    • Double mutants of arnF with other pathway components

    • Overexpression of pathway elements in different mutant backgrounds

    • Heterologous expression of arnF in related bacterial species

  • Substrate accumulation analysis:

    • Detection of Ara4N-undecaprenyl phosphate in membrane fractions

    • Topology studies to determine substrate localization

What controls should be included when evaluating the impact of ArnF on antimicrobial peptide resistance?

Robust experimental design for studying ArnF's role in antimicrobial peptide resistance should include:

  • Essential strain controls:

    • Wild-type Y. pestis

    • ΔarnF single mutant

    • Complete aminoarabinose operon deletion

    • Complemented ΔarnF mutant

    • Point mutants affecting specific ArnF functions

  • Antimicrobial peptide panel:

Peptide TypeExamplesRationale
Natural flea peptidesCheopinEcological relevance
Human/mammalian AMPsDefensins, LL-37Host relevance
Model cationic peptidesPolymyxin B, CRAMPMechanistic studies
Control peptidesNeutral/anionic peptidesSpecificity control
  • Parallel assays:

    • Growth inhibition (MIC/MBC)

    • Membrane permeabilization

    • Peptide binding to bacterial surface

    • Time-kill kinetics

  • Phenotypic validation:

    • Correlation between LPS modification levels and resistance

    • Vector competence in flea infection models

    • Virulence in mammalian models

How can researchers address potential contradictions in data regarding ArnF function across different experimental systems?

Contradictory data in ArnF research may arise from different experimental conditions, bacterial strains, or methodological approaches. To address these:

  • Systematic comparison of variables:

    • Growth conditions (temperature, media, pH)

    • Y. pestis strains (KIM6+, CO92, Antiqua biovars)

    • Expression levels of recombinant proteins

    • Detection methods and sensitivity thresholds

  • Integrated data analysis:

    • Meta-analysis of published results

    • Standardization of key assays across laboratories

    • Development of consensus protocols

  • Collaboration strategies:

    • Round-robin testing of identical samples

    • Exchange of strains and reagents

    • Establishment of standard reference materials

  • Resolution approaches for specific contradictions:

Contradiction TypeInvestigation Strategy
Gene essentialityConditional mutants, different growth conditions
Substrate specificityIn vitro assays with purified components
Interaction partnersMultiple orthogonal interaction detection methods
Regulatory mechanismsGlobal approaches (RNA-Seq, ChIP-Seq) vs. targeted studies

How can researchers distinguish between direct and indirect effects of arnF deletion on Y. pestis physiology?

Deletion of arnF may cause both direct effects (absence of Ara4N modification) and indirect effects (altered membrane properties, stress responses). To distinguish these:

  • Temporal analysis:

    • Immediate versus delayed changes after inducible gene deletion

    • Time-course analysis of transcriptional and physiological responses

  • Complementation hierarchy:

    • Genetic complementation with arnF alone

    • Supplementation with chemically synthesized Ara4N precursors

    • Expression of heterologous flippases with similar function

  • Pathway dissection:

    • Genetic separation of Ara4N synthesis from transport

    • Chemical inhibition of specific steps without genetic manipulation

    • Bypass strategies to achieve similar membrane modifications

  • Systems biology approaches:

    • Network analysis of transcriptomic/proteomic changes

    • Identification of directly and indirectly affected pathways

    • Computational modeling of membrane composition changes

What statistical approaches are most appropriate for analyzing antimicrobial susceptibility data in arnF studies?

Antimicrobial susceptibility data requires appropriate statistical treatment:

  • For MIC/MBC determinations:

    • Report geometric means rather than arithmetic means

    • Use at least 3-5 biological replicates

    • Apply log₂ transformations before statistical analysis

    • Use non-parametric tests for non-normally distributed data

  • For survival assays:

    • Kaplan-Meier analysis for time-to-death experiments

    • Cox proportional hazards models for multiple variable analysis

    • Two-way ANOVA for comparing multiple strains across conditions

  • For binding and permeabilization assays:

    • Area under the curve (AUC) analysis for time-course data

    • Hierarchical clustering for multiparametric phenotyping

    • Principal component analysis for distinguishing strain behaviors

  • For reporting standards:

    • Include raw data alongside statistical summaries

    • Clearly specify statistical tests and significance thresholds

    • Report effect sizes with confidence intervals, not just p-values

How does research on Y. pestis ArnF contribute to understanding antimicrobial resistance mechanisms in other pathogens?

The study of ArnF in Y. pestis provides insights applicable to broader antimicrobial resistance research:

  • Comparative analysis across species:

    • Conservation of arnF and the aminoarabinose operon in Enterobacteriaceae

    • Functional homology with LPS modification systems in distant pathogens

    • Evolutionary patterns of antimicrobial peptide resistance strategies

  • Translational implications:

Research AreaApplication of ArnF Research
Novel antimicrobialsArnF inhibitors as adjuvants to restore AMP sensitivity
Diagnostic markersDetection of Ara4N modification as resistance indicator
Vaccine developmentLPS modifications affecting immune recognition
Vector controlUnderstanding pathogen-vector interactions
  • Methodological advancements:

    • Assay development for membrane modification screening

    • Model systems for studying host-pathogen-vector interactions

    • Technical approaches for membrane protein characterization

What are the most promising future research directions for ArnF and Ara4N modification in Y. pestis?

Priority research areas include:

  • Structural biology:

    • High-resolution structures of ArnF and the flippase complex

    • Conformational changes during substrate translocation

    • Structure-based inhibitor design

  • Systems biology:

    • Global impact of Ara4N modification on bacterial physiology

    • Interaction networks between LPS modification and other cellular processes

    • Mathematical modeling of resistance mechanisms

  • Host-pathogen interactions:

    • Dynamic regulation of Ara4N modification during infection

    • Impact on innate immune signaling pathways

    • Contribution to persistent infection

  • Vector biology:

    • Comprehensive characterization of flea antimicrobial peptides

    • Mechanisms of Y. pestis survival in the flea digestive tract

    • Co-evolution of Y. pestis and flea immune defenses

  • Therapeutic applications:

    • ArnF inhibitors as antivirulence compounds

    • Combination therapies targeting both Ara4N modification and other processes

    • Vaccines incorporating modified LPS structures

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.