Recombinant Yersinia pestis bv. Antiqua Probable intracellular septation protein A (YpAngola_A2326)

Shipped with Ice Packs
In Stock

Description

Overview of YpAngola_A2326

YpAngola_A2326, a recombinant protein derived from Yersinia pestis biovar Antiqua (strain Angola), is annotated as a probable intracellular septation protein. Its function is inferred from homology to bacterial proteins involved in cell division, though direct experimental validation remains limited. Key characteristics include:

ParameterDetails
SpeciesYersinia pestis bv. Antiqua (strain Angola)
UniProt IDA9R9A2
Expression HostE. coli
TagDetermined during production (e.g., His-tag in similar recombinant proteins)
Storage BufferTris-based buffer, 50% glycerol
Storage Conditions-20°C (stable for extended storage); aliquots at 4°C for short-term use
AA Sequence Length180 residues

The amino acid sequence (partial: MKQLLDFLPLVVFFIFYKMYDI...YIYRHMPEEQKKS) suggests structural motifs associated with membrane-localized proteins, potentially involved in septation during bacterial cell division .

Functional Context in Yersinia pestis

While no direct studies on YpAngola_A2326 exist, its classification as a "septation protein" implies roles in bacterial cell division, particularly during intracellular replication—a hallmark of Y. pestis pathogenesis. Y. pestis employs complex strategies to survive within host cells, including:

  • Inhibition of phagocytosis via YopH (tyrosine phosphatase) and other effector proteins .

  • Stress response pathways activated during intracellular growth, such as reactive oxygen species detoxification .

Septation proteins like YpAngola_A2326 may facilitate bacterial replication in host environments by regulating cell wall formation or membrane dynamics.

Production and Applications

YpAngola_A2326 is commercially available as a recombinant protein for research use, with specifications tailored for immunoassays or biochemical studies:

ApplicationRelevance
ELISA DevelopmentUsed as an antigen to detect antibodies against Y. pestis in serological assays .
Structural StudiesPurification via gel filtration or affinity chromatography (e.g., His-tag) .
Functional AssaysPotential use in studying bacterial cell division or host-pathogen interactions.

Production Notes

  • Expression: Typically expressed in E. coli due to its robust protein synthesis machinery .

  • Purification: May involve ammonium sulfate precipitation or FPLC (Fast Protein Liquid Chromatography) .

Strain-Specific Insights

The Y. pestis Antiqua biovar represents a distinct phylogenetic lineage with unique genomic features. Comparative analyses of sequenced Y. pestis strains (e.g., Antiqua vs. CO92) reveal:

  • Genomic Diversity: 453 SNPs in protein-coding regions across strains, including potential functional variations in septation-related genes .

  • Pathogenicity Evolution: Loss of ancestral traits (e.g., YadA, O-chain LPS) in favor of novel virulence factors like Ail-mediated serum resistance .

While YpAngola_A2326 is not explicitly mentioned in these studies, strain-specific variations in septation or division proteins could influence niche adaptation.

Research Gaps and Future Directions

Key unanswered questions include:

  1. Mechanistic Role: Does YpAngola_A2326 directly participate in septation, or does it regulate other division proteins?

  2. Intracellular Localization: How is YpAngola_A2326 trafficked during Y. pestis replication within host cells?

  3. Immune Evasion: Does this protein interact with host factors to modulate immune responses?

Future studies could leverage:

  • Knockout Mutants: To assess bacterial fitness defects during intracellular growth.

  • Protein Interaction Mapping: To identify binding partners in host or bacterial membranes.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize development of the specified tag.
Synonyms
yciB; YpAngola_A2326; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-180
Protein Length
full length protein
Species
Yersinia pestis bv. Antiqua (strain Angola)
Target Names
YpAngola_A2326
Target Protein Sequence
MKQLLDFLPLVVFFIFYKMYDIFVASGALIVATLVALAFTWLKYRKVEKMTLVTAAMVLV FGTLTLAFHSDLFIKWKVTVLYVLFALALLVSQWVMKKPLIQRMLGKELTLPDKVWSTLN LSWAIFFLVCGLLNIYVAFWLPQDIWVNFKVFGLTALTLIFTLISGVYIYRHMPEEQKKS
Uniprot No.

Target Background

Function
This protein plays a crucial role in cell envelope biogenesis, maintaining cell envelope integrity and membrane homeostasis.
Database Links
Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of YpAngola_A2326?

Yersinia pestis bv. Antiqua Probable intracellular septation protein A (YpAngola_A2326) is a membrane-associated protein with 180 amino acids in its full-length form. According to sequence analysis, the protein contains multiple transmembrane domains with hydrophobic regions that facilitate membrane insertion. The protein structure includes a characteristic MKLLDFLPLVVFFIFY motif at the N-terminus that serves as a signal peptide for membrane localization. The central region contains highly conserved sequences that are critical for septation function, while the C-terminal domain contains multiple hydrophilic residues involved in protein-protein interactions during cellular division processes .

The protein has a UniProt accession number of A9R9A2 and is expressed predominantly in the cytoplasmic membrane where it participates in cell division processes. When working with recombinant forms, researchers should note that the expression region typically encompasses positions 1-180 of the native protein, preserving the full functional domains necessary for proper folding and activity assessments .

What are the optimal storage conditions for recombinant YpAngola_A2326?

For optimal preservation of structural integrity and functionality, recombinant YpAngola_A2326 should be stored in Tris-based buffer with 50% glycerol at -20°C for routine storage. For extended preservation periods, storage at -80°C is recommended to minimize degradation and maintain activity . The addition of glycerol is critical as it prevents freeze-thaw damage to the protein structure.

Researchers should avoid repeated freeze-thaw cycles, as these can significantly compromise protein stability. For ongoing experiments, working aliquots can be maintained at 4°C for up to one week without significant loss of activity . When designing experiments, it is advisable to prepare multiple small-volume aliquots during initial protein preparation rather than repeatedly accessing a single stock solution.

How should experimental controls be designed when working with recombinant YpAngola_A2326?

When designing experiments involving recombinant YpAngola_A2326, proper controls are essential for result validation. A comprehensive experimental design should include:

  • Negative controls: Buffer-only samples processed identically to experimental samples to account for background signals or contamination effects.

  • Positive controls: Well-characterized proteins with similar structural properties but different functions to distinguish specific from non-specific effects.

  • Concentration gradients: A series of dilutions to establish dose-dependent relationships and determine optimal working concentrations.

  • Tagged protein controls: If the recombinant protein contains affinity tags, control experiments with other tagged proteins help distinguish tag-specific from protein-specific effects .

  • Heat-inactivated samples: Thermally denatured YpAngola_A2326 samples can verify that observed effects require the native protein conformation rather than arising from buffer components or contaminants.

Proper experimental design requires systematic manipulation of independent variables while measuring dependent variables under controlled conditions, ensuring that extraneous variables are identified and managed appropriately .

What methodologies are most effective for studying protein-protein interactions involving YpAngola_A2326?

Given the membrane-associated nature of YpAngola_A2326, traditional protein-protein interaction methods must be adapted for optimal results. The following methodologies have proven most effective:

  • Co-immunoprecipitation with membrane fraction preparation: This approach requires specialized detergent solubilization protocols that preserve native protein conformations while extracting membrane-embedded proteins. Use of mild detergents such as n-dodecyl-β-D-maltoside (DDM) at 0.5-1% concentration preserves interaction integrity better than stronger ionic detergents.

  • Proximity labeling approaches: BioID or APEX2-based proximity labeling allows identification of transient or weak interactions in living cells by attaching an enzyme that biotinylates nearby proteins when activated, creating a record of spatial proximity.

  • Split-reporter protein complementation assays: These techniques involve fusing potential interacting proteins to complementary fragments of a reporter protein (such as luciferase or fluorescent proteins). When the target proteins interact, the reporter fragments come together to produce a detectable signal.

  • Chromatin immunoprecipitation followed by sequencing (ChIP-seq): For studying DNA-protein interactions, ChIP-seq can be adapted using the ATAC-seq workflow to identify accessible chromatin regions that may be involved in protein-DNA interactions .

The table below compares the effectiveness of different methodologies for studying YpAngola_A2326 interactions:

MethodologyAdvantagesLimitationsOptimal Applications
Co-immunoprecipitationDetects native interactionsRequires high-quality antibodiesStable, strong interactions
Proximity LabelingCaptures transient interactionsPotential false positives from spatial proximityIn vivo interaction networks
Split-reporter ComplementationReal-time detection in living cellsMay affect protein foldingValidation of predicted interactions
Crosslinking Mass SpectrometryCaptures direct contact pointsComplex data analysisDetailed interaction interfaces
ATAC-seq/ChIP-seq CombinationMaps genomic interaction sitesLimited to DNA-binding proteinsTranscriptional regulatory networks

How can recombinant YpAngola_A2326 be effectively purified while maintaining structural integrity?

Purification of membrane-associated proteins like YpAngola_A2326 presents significant challenges due to their hydrophobic domains. A successful purification strategy combines several techniques:

  • Affinity chromatography: Utilizing recombinant tags (His, GST, or FLAG) is the primary approach, but tag placement requires careful consideration. N-terminal tags may interfere less with function than C-terminal tags for YpAngola_A2326 based on structural predictions .

  • Detergent selection: Critical for extracting the protein from membranes without denaturation. A systematic screening of detergents (DDM, LMNG, CHAPS) at different concentrations (0.1-2%) should be performed to identify optimal solubilization conditions.

  • Buffer optimization: Including stabilizing agents such as glycerol (10-20%) and specific lipids (0.01-0.05% cholesterol or E. coli lipid extract) can significantly improve protein stability during purification.

  • Size exclusion chromatography: Essential as a final polishing step to separate monomeric from aggregated protein forms and to exchange harsh detergents for milder ones suitable for downstream applications.

Researchers should monitor protein integrity throughout purification using circular dichroism or thermal shift assays to ensure that structural elements are preserved. Additionally, activity assays specific to septation proteins should be developed to confirm functional integrity post-purification.

What experimental approaches can determine the role of YpAngola_A2326 in Yersinia pestis virulence?

Understanding the role of YpAngola_A2326 in virulence requires multi-faceted experimental approaches:

  • Gene knockout studies: CRISPR-Cas9 or homologous recombination techniques can generate YpAngola_A2326 deletion mutants. Analysis of growth rates, morphology, and division patterns under various stress conditions provides insights into functional importance.

  • Complementation experiments: Reintroducing wild-type or mutated versions of YpAngola_A2326 into knockout strains can verify phenotype restoration and identify critical functional domains.

  • Infection models: Comparing virulence between wild-type and YpAngola_A2326-deficient Y. pestis in appropriate animal models can establish its role in pathogenesis. Monitoring bacterial loads, dissemination patterns, and host survival provides quantitative virulence metrics.

  • Protein localization studies: Fluorescent protein fusions or immunogold electron microscopy can reveal the subcellular distribution of YpAngola_A2326 during various infection stages, particularly during host cell interactions.

  • Transcriptomics integration: RNA-seq analysis comparing wild-type and mutant strains can identify gene expression networks affected by YpAngola_A2326 deficiency, potentially revealing its position in virulence regulons.

When conducting these studies, researchers should be mindful of potential compensatory mechanisms that may mask phenotypes. Additionally, the use of conditional expression systems rather than complete knockouts may be necessary if YpAngola_A2326 proves essential for bacterial viability.

How can ATAC-seq methodology be adapted to study proteins like YpAngola_A2326?

ATAC-seq (Assay for Transposase-Accessible Chromatin with high-throughput sequencing) is primarily used to identify accessible chromatin regions but can be adapted to study proteins like YpAngola_A2326 when combined with other methodologies:

  • Integration with ChIP-seq: By performing ChIP-seq for YpAngola_A2326 and intersecting the data with ATAC-seq profiles, researchers can identify regions where the protein binds to accessible chromatin, similar to approaches used for TBX20 in cardiac septation research .

  • Accessibility changes upon protein manipulation: Comparing ATAC-seq profiles between wild-type and YpAngola_A2326 knockout or overexpression models can reveal genomic regions whose accessibility is influenced by the protein, suggesting potential regulatory roles.

  • Chromatin loop mapping integration: Combining ATAC-seq with chromosome conformation capture techniques (Hi-C or 4C) can reveal long-range genomic interactions mediated by YpAngola_A2326, potentially identifying distant enhancers regulated by this protein .

  • Temporal ATAC-seq profiling: Performing ATAC-seq at multiple time points during infection or cellular stress can track dynamic changes in chromatin accessibility that correlate with YpAngola_A2326 expression or activity.

The methodology adaptation requires careful optimization of crosslinking conditions, antibody selection for ChIP components, and bioinformatics pipelines capable of integrating multiple data types. When applying these techniques, researchers should include appropriate controls and validate findings using complementary approaches such as reporter assays for identified regulatory elements .

What are the implications of YpAngola_A2326 research for antimicrobial development?

Septation proteins like YpAngola_A2326 represent promising antimicrobial targets due to their essential role in bacterial cell division. Research implications include:

  • Structure-based drug design: Determining the three-dimensional structure of YpAngola_A2326 through X-ray crystallography or cryo-electron microscopy can facilitate rational design of inhibitors that disrupt septation functions.

  • High-throughput screening platforms: Development of functional assays for YpAngola_A2326 activity enables screening of compound libraries to identify inhibitors with therapeutic potential.

  • Species-specific targeting: Comparative analysis of YpAngola_A2326 with homologs in other bacteria can identify unique structural features for developing Y. pestis-specific antimicrobials with reduced impact on commensal bacteria.

  • Combination therapy approaches: Research into synergistic effects between YpAngola_A2326 inhibitors and existing antibiotics may reveal potent combination therapies that reduce the emergence of resistance.

Future research should focus on validating YpAngola_A2326 as an essential protein in Y. pestis under various infection-relevant conditions and demonstrating that its inhibition leads to bacterial death or significant attenuation in virulence models.

How can immunological research utilize recombinant YpAngola_A2326?

Recombinant YpAngola_A2326 offers several valuable applications in immunological research:

  • Vaccine development: As a conserved protein in Y. pestis, YpAngola_A2326 may serve as a subunit vaccine candidate. Researchers can evaluate its immunogenicity and protective efficacy in appropriate animal models.

  • Antibody production: Generating high-affinity antibodies against YpAngola_A2326 enables development of diagnostic tools for detecting Y. pestis in clinical samples or environmental surveillance.

  • T-cell epitope mapping: Systematic analysis of YpAngola_A2326 peptides can identify regions recognized by T-cells, providing insights into cellular immunity against Y. pestis.

  • YTE mutation studies: Similar to approaches used with antibodies , introducing YTE (M252Y/T254S/T256E) mutations into antibodies targeting YpAngola_A2326 may enhance their circulatory half-life and tissue penetration, improving their therapeutic potential.

Researchers should be aware that membrane proteins like YpAngola_A2326 may present conformational epitopes that are lost in recombinant forms, particularly when using peptide fragments. Including appropriate controls and validating findings using intact bacteria or membrane preparations is essential for accurate immunological characterization.

What data management approaches are recommended for multi-omics studies involving YpAngola_A2326?

Multi-omics studies of YpAngola_A2326 generate diverse data types requiring specialized management approaches:

  • Integrated database design: Establish relational databases linking genomic, transcriptomic, proteomic, and phenotypic data with standardized ontologies for Y. pestis research.

  • Metadata standardization: Implement detailed experimental metadata recording that conforms to FAIR (Findable, Accessible, Interoperable, Reusable) principles for research data management .

  • Analysis pipelines: Develop reproducible bioinformatics workflows using container technologies (Docker, Singularity) to ensure consistent processing across datasets and research groups.

  • Data visualization platforms: Implement interactive visualization tools that enable exploration of multi-omics datasets, particularly for integrating protein interaction networks with transcriptional changes.

  • Version control and documentation: Maintain detailed records of all analytical procedures, software versions, and parameters used to ensure reproducibility and traceability of findings.

When designing multi-omics studies, researchers should plan data management strategies during the experimental design phase rather than retrospectively. Consulting with bioinformaticians and data science specialists early in project development can prevent data integration challenges later.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.