Recombinant Yersinia pestis bv. Antiqua Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Yersinia pestis bv. Antiqua prolipoprotein diacylglyceryl transferase (Lgt) is a bacterial enzyme critical for posttranslational modification of lipoproteins. Lgt catalyzes the transfer of a diacylglyceryl moiety from phosphatidylglycerol to the thiol group of a conserved cysteine residue in prolipoproteins, forming thioether bonds essential for anchoring lipoproteins to bacterial membranes . This enzyme is encoded by the lgt gene (locus YPN_2989 in Y. pestis Antiqua strain Nepal516) and is indispensable for lipoprotein maturation, membrane integrity, and virulence in Gram-negative pathogens .

Role in Bacterial Pathogenesis

  • Virulence: Lgt is essential for Y. pestis survival and infectivity. Loss of Lgt activity disrupts lipoprotein anchoring, compromising membrane integrity and increasing susceptibility to host defenses .

  • Evolutionary Adaptation: Y. pestis lacks the O-antigen of lipopolysaccharide (LPS), exposing core LPS to interact with host immune receptors like SIGNR1 (CD209b). This interaction facilitates bacterial dissemination via antigen-presenting cells, a process potentially modulated by lipoprotein-mediated signaling .

Antibacterial Target Potential

  • Inhibitor Studies: Novel Lgt inhibitors disrupt outer membrane integrity in E. coli and Acinetobacter baumannii, leading to bactericidal effects. These inhibitors target the conserved phosphatidylglycerol-binding site, suggesting applicability against Y. pestis Lgt .

  • Phenotypic Effects: Lgt depletion increases bacterial sensitivity to serum killing and antibiotics, validating its role as a therapeutic target .

Recombinant Expression

  • Cloning: The lgt gene is expressed in E. coli with a His-tag for purification .

  • Functional Validation: Activity confirmed via complementation assays in Lgt-deficient strains .

Table 2: Comparative Analysis of Lgt Across Bacterial Species

SpeciesSequence IdentityKey Conserved ResiduesEssential for Viability
Y. pestis Antiqua100%Y26, N146, G154, R143, E151Yes (Gram-negative)
E. coli47% similarityY24, N144, G152Yes
Staphylococcus aureus24% identityY22, N140, G148No (Gram-positive)

Implications for Vaccine Development

While Lgt itself is not a direct vaccine candidate, its role in lipoprotein maturation informs strategies targeting bacterial virulence. For example, recombinant Y. pestis F1 antigen (a capsular protein) has been successfully produced in plants and E. coli for subunit vaccines . Understanding Lgt’s function aids in designing inhibitors to disrupt Y. pestis membrane biogenesis, complementing existing vaccine approaches .

Future Directions

  • Structural Studies: High-resolution crystallography of Y. pestis Lgt could reveal species-specific drug-binding pockets.

  • In Vivo Models: Testing Lgt inhibitors in Y. pestis infection models will validate therapeutic efficacy.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. To ensure a specific tag type, please inform us during your order; we will prioritize fulfilling your request.
Synonyms
lgt; YpAngola_A3239; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Yersinia pestis bv. Antiqua (strain Angola)
Target Names
lgt
Target Protein Sequence
MSNSYLAFPKFDPVIFSIGPVSLHWYGLMYLVGFVFAMWLAVRRANKPGSGWTKEEVENL LYAGFLGVFIGGRVGYVLFYNLPMFLDNPLYLFKVWDGGMSFHGGLIGVICVMLWFARRT KRNFFQVADFIAPLIPFGLGAGRLGNFINAELWGRVTTDTPWAMLFPTSRNTDIAIVAAD PAKWQAIFNQYGVLPRHPSQLYEMILEGVVLFIILNVFIRKPRPMGSVSGLFLIGYGTFR IIVECFRQPDEQLGLFEGMISMGQILSVPMILAGIIMMIWAYRRPTQKLS
Uniprot No.

Target Background

Function

This recombinant Yersinia pestis bv. Antiqua prolipoprotein diacylglyceryl transferase (Lgt) catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the maturation of lipoproteins.

Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of prolipoprotein diacylglyceryl transferase (lgt) in Yersinia pestis?

Prolipoprotein diacylglyceryl transferase (lgt) catalyzes the first step in the three-step post-translational lipid modification pathway of bacterial lipoproteins. In Y. pestis, as in other Gram-negative bacteria, lgt transfers a diacylglyceryl group from phosphatidylglycerol to the conserved cysteine residue in the "lipobox" of prolipoproteins. This modification is essential for bacterial survival, as lipoproteins perform crucial functions including maintenance of cell envelope architecture, nutrient uptake, transport, adhesion, invasion and virulence . The lgt gene is considered essential in most Gram-negative bacteria, and its deletion is typically lethal, underscoring its fundamental importance to bacterial physiology .

How does lgt contribute to Y. pestis pathogenicity?

Lgt contributes to Y. pestis pathogenicity by enabling the proper processing and localization of multiple lipoproteins involved in virulence. Y. pestis, the causative agent of plague, relies on properly processed lipoproteins for various aspects of its infectious cycle. While specific research on Y. pestis lgt is limited in the provided materials, studies on bacterial lipoproteins show they fulfill wide-ranging and vital biological functions critical to bacterial survival and infection, including maintenance of cell envelope architecture, insertion and stabilization of outer membrane proteins, and various virulence mechanisms . Properly processed lipoproteins contribute to the bacterium's ability to evade host immune responses and establish infection. The importance of lipoproteins in Y. pestis virulence is demonstrated by studies on specific lipoproteins like NlpD, which has been shown to be essential for Y. pestis virulence in both bubonic and pneumonic plague models .

What are the optimal methods for cloning and expressing recombinant Y. pestis lgt?

For cloning and expressing recombinant Y. pestis lgt, researchers should consider several methodological approaches tailored to membrane proteins. The lgt gene should be amplified from Y. pestis bv. Antiqua genomic DNA using high-fidelity polymerase and primers designed to include appropriate restriction sites. For expression, E. coli is typically used as a host system, with specialized strains like C41(DE3) or C43(DE3) that are optimized for membrane protein expression. Expression vectors containing inducible promoters (such as T7 or araBAD) with appropriate fusion tags (His6, MBP, or SUMO) can facilitate purification and enhance solubility. Expression conditions must be carefully optimized, with reduced temperature (16-25°C) and lower inducer concentrations to prevent formation of inclusion bodies. Similar approaches have been successfully applied to related membrane proteins, as demonstrated in the structural study of E. coli Lgt, where researchers obtained crystals that diffracted to 1.9 Å resolution . Purification typically involves detergent solubilization followed by affinity chromatography and size exclusion chromatography to obtain homogeneous protein preparations.

How can researchers design effective mutagenesis studies to identify critical residues in Y. pestis lgt?

Designing effective mutagenesis studies for Y. pestis lgt should begin with computational analysis to identify conserved residues across bacterial species. Based on available structural data from E. coli Lgt, researchers should prioritize residues in the active site and substrate binding pockets. The crystal structures of E. coli Lgt in complex with phosphatidylglycerol and the inhibitor palmitic acid have revealed important binding sites that can guide mutagenesis . Site-directed mutagenesis should target:

  • Catalytic residues (like Arg143 and Arg239 identified in E. coli Lgt as essential for diacylglyceryl transfer)

  • Residues involved in substrate binding

  • Residues at the membrane interface that may facilitate substrate entry

Complementation assays using lgt-knockout cells are particularly valuable for functional validation, as demonstrated in E. coli studies where different mutant Lgt variants were tested for their ability to rescue the lethal phenotype . Activity assays can be developed using GFP-based in vitro methods to correlate structure with function. When designing the experimental workflow, researchers should include appropriate controls and consider multiple amino acid substitutions at key positions (conservative and non-conservative) to thoroughly characterize the functional importance of each residue.

What approaches are recommended for studying the interaction between lgt and its substrates?

To study interactions between Y. pestis lgt and its substrates, researchers should employ multiple complementary techniques:

  • In vitro binding assays: Using purified recombinant lgt and synthetic substrates (phosphatidylglycerol and prolipoprotein peptides containing the lipobox motif), binding affinities can be determined through isothermal titration calorimetry or surface plasmon resonance.

  • Structural biology techniques: X-ray crystallography has proven successful for E. coli Lgt, yielding structures at 1.9 and 1.6 Å resolution in complex with phosphatidylglycerol and palmitic acid inhibitor . Cryo-EM might be suitable for capturing larger complexes.

  • Computational modeling: Molecular dynamics simulations can model how substrates enter laterally from the membrane into the active site, as suggested by structural and biochemical data from E. coli Lgt .

  • Activity assays: GFP-based in vitro assays can correlate structure with function by monitoring the transfer of diacylglyceryl groups to fluorescently labeled prolipoprotein peptides .

  • Cross-linking studies: Chemical cross-linking coupled with mass spectrometry can identify residues in close proximity during substrate binding.

These methodologies should be integrated to develop a comprehensive understanding of the substrate interaction mechanisms, particularly focusing on how substrates and products enter and leave the enzyme laterally relative to the lipid bilayer, as proposed for E. coli Lgt .

What structural features distinguish Y. pestis lgt from homologs in other bacterial species?

While the search results don't provide specific structural information about Y. pestis lgt, insights can be drawn from the E. coli homolog. E. coli Lgt crystal structures have been determined at high resolution (1.9 and 1.6 Å) in complex with phosphatidylglycerol and palmitic acid inhibitor . These structures revealed two binding sites that support previously reported structure-function relationships. Key features likely conserved in Y. pestis lgt include:

  • Transmembrane domains that anchor the protein in the bacterial membrane

  • Critical catalytic residues, including Arg143 and Arg239, which are essential for diacylglyceryl transfer activity

  • Binding pockets that accommodate phosphatidylglycerol and the lipobox-containing peptide substrate

The mechanism supported by structural and biochemical data suggests that both substrate and product (lipid-modified lipobox-containing peptide) enter and leave the enzyme laterally relative to the lipid bilayer . Comparative structural analysis between Y. pestis lgt and homologs from other pathogenic and non-pathogenic bacteria would be valuable for identifying unique features that might be exploited for species-specific inhibition, particularly given Y. pestis's role as a high-priority pathogen.

How can researchers determine the enzymatic activity of recombinant Y. pestis lgt in vitro?

Researchers can determine the enzymatic activity of recombinant Y. pestis lgt using several complementary approaches:

  • GFP-based activity assays: Similar to the assay developed for E. coli Lgt, this method uses fluorescently labeled prolipoprotein peptides to monitor the transfer of diacylglyceryl groups . The change in fluorescence properties upon lipid modification provides a quantitative readout of enzyme activity.

  • Radiolabeled substrate assays: Using 14C or 3H-labeled phosphatidylglycerol as a substrate allows for direct quantification of diacylglyceryl transfer to acceptor peptides.

  • Mass spectrometry-based assays: This approach can precisely identify and quantify the lipid-modified products by detecting the mass shift after diacylglyceryl transfer.

  • Complementation of lgt-deficient strains: Functional activity can be assessed by the ability of recombinant Y. pestis lgt to rescue the growth of conditional lgt-knockout bacterial strains.

A standardized enzymatic assay protocol should include:

  • Purified recombinant Y. pestis lgt reconstituted in appropriate membrane mimetics (detergent micelles or liposomes)

  • Synthetic lipobox-containing peptide substrates

  • Phosphatidylglycerol as the lipid donor

  • Appropriate buffer conditions (pH, ionic strength, divalent cations)

  • Controls including heat-inactivated enzyme and known lgt inhibitors

Activity measurements should be performed under conditions that maintain the native membrane environment as closely as possible, as the lateral movement of substrates and products relative to the lipid bilayer appears to be a critical aspect of the enzyme mechanism .

What is the relationship between protein structure and function in Y. pestis virulence factors processed by lgt?

The relationship between structure and function in Y. pestis virulence factors processed by lgt is exemplified by studies on specific lipoproteins like the F1 antigen and NlpD. The F1 antigen exists as a multimer of high molecular mass, which can dissociate after heating in the presence of SDS and reassociate upon SDS removal . This multimeric structure appears to be functionally significant, as mice immunized with multimeric recombinant F1 (rF1) showed significantly better protection against Y. pestis challenge compared to those immunized with monomeric rF1 (5/7 vs 1/7 survival rate) .

For the NlpD lipoprotein, proper processing by the lipoprotein modification pathway (which begins with lgt-mediated diacylglyceryl transfer) is essential for its function as a virulence factor. Deletion of the nlpD gene resulted in a dramatic reduction in virulence, with an LD50 of at least 107 CFU for both subcutaneous and airway routes of infection, and the mutant was unable to colonize mouse organs following infection . The filamented morphology of the nlpD mutant indicates its involvement in cell separation, demonstrating how structural features directly impact functional roles .

These examples illustrate how the three-dimensional structure of lipoproteins, properly processed through the pathway initiated by lgt, directly influences their functional properties in virulence. The quaternary structure of multimeric virulence factors and the proper localization of lipoproteins within the cell envelope are critical determinants of their biological activity and contribution to pathogenesis.

How does disruption of lgt affect Y. pestis virulence in animal models?

While the search results don't provide direct information about lgt knockout studies in Y. pestis, inferences can be made based on studies of other lipoproteins in this pathogen. The essential nature of lgt in most Gram-negative bacteria suggests that complete knockout would likely be lethal or severely attenuating for Y. pestis . Studies of specific lipoproteins processed by the pathway initiated by lgt provide indirect evidence of the importance of this processing for virulence.

For example, the NlpD lipoprotein, which requires processing through the lipoprotein modification pathway, has been demonstrated to be essential for Y. pestis virulence. A chromosomal deletion of the nlpD gene resulted in a drastic reduction in virulence to an LD50 of at least 107 CFU for both subcutaneous and airway routes of infection, and the mutant was unable to colonize mouse organs following infection . This suggests that disruption of the lipoprotein processing pathway, of which lgt catalyzes the first and essential step, would likely have profound effects on Y. pestis virulence.

Research on other bacterial pathogens has shown that lgt mutants exhibit reduced virulence and altered immune recognition, suggesting that similar phenotypes might be observed in Y. pestis if viable lgt mutants could be generated, perhaps through conditional or partial disruption approaches.

What is the potential of Y. pestis lgt as a target for novel antimicrobial development?

Y. pestis lgt represents a promising target for novel antimicrobial development for several compelling reasons:

  • Essentiality: Lgt catalyzes the first and critical step in bacterial lipoprotein processing, and its gene deletion is lethal to most Gram-negative bacteria , suggesting inhibitors would have bactericidal activity.

  • Conservation and uniqueness: Lgt is highly conserved across bacterial species but absent in humans, reducing the risk of target-based toxicity.

  • Structural information: The available high-resolution crystal structures of E. coli Lgt (1.9 and 1.6 Å) in complex with substrates and inhibitors provide valuable templates for structure-based drug design approaches that could be applied to Y. pestis lgt .

  • Virulence connection: Properly processed lipoproteins are essential for Y. pestis virulence, as demonstrated by studies on specific lipoproteins like NlpD, which is crucial for both bubonic and pneumonic plague pathogenesis .

  • Public health significance: Y. pestis is classified as a Tier 1 Select Agent due to its low infectious dose and high case-fatality rate in untreated infections , making new treatment options particularly valuable.

Potential drug development strategies could include high-throughput screening of compound libraries against recombinant Y. pestis lgt, fragment-based drug discovery utilizing the known binding sites, and rational design of peptidomimetics targeting the lipobox recognition site. The known inhibitor palmitic acid, which has been co-crystallized with E. coli Lgt , could serve as a starting point for structure-based optimization of lipid-like inhibitors with improved potency and pharmacokinetic properties.

How do environmental conditions affect the expression and activity of lgt in Y. pestis?

While the search results don't provide specific information about environmental regulation of lgt in Y. pestis, general principles of bacterial gene regulation suggest several factors likely influence its expression and activity:

  • Temperature-dependent regulation: Y. pestis transitions between flea vectors (≈26°C) and mammalian hosts (37°C). This temperature shift triggers extensive transcriptional reprogramming, and lgt expression may be regulated as part of this adaptation process.

  • Nutrient availability: Phospholipid availability, particularly phosphatidylglycerol (the substrate for lgt), would directly impact enzymatic activity. Under phospholipid-limited conditions, lgt activity might become a bottleneck in lipoprotein processing.

  • pH and ionic conditions: As Y. pestis encounters varying pH environments during infection (from acidic phagolysosomes to neutral extracellular spaces), enzymatic activity of membrane-associated proteins like lgt could be affected.

  • Oxygen tension: The transition from aerobic to microaerobic or anaerobic conditions during infection might influence the expression of genes involved in membrane biogenesis, including lgt.

  • Host factors: Host-derived antimicrobial peptides or other immune factors may induce stress responses that alter membrane protein expression patterns.

Future research should investigate the transcriptional and post-transcriptional regulation of lgt under various environmental conditions relevant to the Y. pestis lifecycle, particularly during the transition from flea vector to mammalian host and during adaptation to different host tissues during infection progression. Understanding these regulatory patterns could reveal vulnerabilities in the bacterial life cycle that might be exploited for therapeutic intervention.

How does Y. pestis lgt compare to homologs in other Yersinia species and related pathogens?

The Lgt protein belongs to a conserved family of enzymes present across Gram-negative bacteria. The E. coli Lgt, which has been structurally characterized, provides a useful comparison point . Key functional residues such as Arg143 and Arg239, which are essential for diacylglyceryl transfer activity in E. coli Lgt, are likely conserved in Y. pestis and other Gram-negative pathogens .

Comparative genomic analyses of lgt across pathogenic species could reveal:

  • Conserved regions that represent functionally critical domains

  • Variable regions that might contribute to species-specific substrate preferences or regulatory mechanisms

  • Evidence of selective pressure that might indicate host-pathogen co-evolution

Such comparative analyses would be valuable for understanding the fundamental biology of bacterial lipoprotein processing and for identifying conserved features that could serve as broad-spectrum antimicrobial targets versus species-specific targets for more tailored therapeutic approaches.

What methodological approaches are recommended for phylogenetic analysis of lgt across bacterial species?

For phylogenetic analysis of lgt across bacterial species, researchers should implement a comprehensive methodological workflow:

  • Sequence retrieval and alignment:

    • Obtain lgt sequences from diverse bacterial species, including multiple strains of Y. pestis, other Yersinia species, and representatives from other bacterial families

    • Use multiple sequence alignment tools (MUSCLE, MAFFT, or T-Coffee) with parameters optimized for membrane proteins

    • Manually curate alignments to ensure accurate positioning of conserved motifs and domains

  • Model selection and tree construction:

    • Employ ModelTest or similar tools to identify the best-fit evolutionary model for the dataset

    • Construct phylogenetic trees using multiple methods for robustness:

      • Maximum Likelihood (RAxML or IQ-TREE)

      • Bayesian inference (MrBayes or BEAST)

      • Maximum Parsimony

    • Implement appropriate bootstrapping (1000+ replicates) or posterior probability assessments

  • Structural correlation:

    • Map conserved and variable regions onto available three-dimensional structures

    • Identify patterns of co-evolution within functional domains

    • Correlate phylogenetic patterns with structural and functional data

  • Contextual analysis:

    • Consider genome context (synteny) around the lgt gene in different species

    • Analyze potential horizontal gene transfer events using methods like reconciliation analysis

    • Examine selection pressures using dN/dS ratio analyses to identify positions under positive or purifying selection

This comprehensive approach would allow researchers to reconstruct the evolutionary history of lgt within the context of bacterial speciation and adaptation, potentially revealing insights into how variations in this essential enzyme might contribute to the diverse virulence strategies observed across bacterial pathogens.

How can researchers effectively analyze variations in lgt sequences across Y. pestis strains from different geographical origins?

To effectively analyze variations in lgt sequences across Y. pestis strains from different geographical origins, researchers should implement a multi-faceted approach that combines genomic analysis with contextual epidemiological data:

  • Comprehensive sampling strategy:

    • Include representative strains from all major biovars (Antiqua, Medievalis, Orientalis) and geographical regions

    • Incorporate historical isolates when available to capture temporal variation

    • Ensure adequate representation of environmental, animal, and human isolates

  • Sequence analysis methods:

    • Perform whole-genome sequencing of strains or targeted sequencing of the lgt gene and flanking regions

    • Implement SNP (Single Nucleotide Polymorphism) analysis to identify point mutations

    • Examine insertion/deletion events and potential recombination signatures

    • Use appropriate statistical methods for detecting population structure and geographical clustering

  • Structure-function correlation:

    • Map sequence variations onto the three-dimensional structure (using homology models based on E. coli Lgt if Y. pestis-specific structures are unavailable)

    • Assess whether variations cluster in particular functional domains

    • Experimentally validate the functional impact of key variants through site-directed mutagenesis and activity assays

  • Data visualization and integration:

    • Develop geographical maps that display the distribution of specific variants

    • Integrate phylogenetic data with historical plague outbreak records

    • Employ network analysis to visualize relationships between strains and potential transmission routes

  • Statistical framework for detecting adaptation:

    • Implement statistical tests to identify signatures of selection

    • Use phylogeographic methods to reconstruct the spread of specific variants

    • Apply Bayesian skyline analyses to estimate changes in effective population size over time

This integrated approach would enable researchers to reconstruct the evolutionary history of lgt in Y. pestis populations, potentially revealing adaptations associated with geographical spread, host switching events, or changes in virulence over time. Such information could provide valuable insights into the evolution of plague as a human pathogen and inform surveillance efforts focused on emerging variants.

What are the current technical challenges in expressing and purifying functional recombinant Y. pestis lgt?

The expression and purification of functional recombinant Y. pestis lgt faces several technical challenges inherent to membrane proteins:

  • Expression system limitations:

    • Toxicity to host cells due to membrane disruption when overexpressed

    • Formation of inclusion bodies rather than proper membrane integration

    • Inefficient folding in heterologous expression systems

    • The need for specialized E. coli strains (like C41/C43) designed for membrane protein expression

  • Purification complexities:

    • Requirement for detergents or membrane mimetics that maintain native structure

    • Finding optimal detergent conditions that extract lgt without denaturing it

    • Low yields compared to soluble proteins

    • Potential heterogeneity in lipid composition of the purified protein

  • Activity preservation:

    • Maintaining the native membrane environment necessary for catalytic activity

    • Ensuring co-purification of essential lipids that might be required for structural integrity

    • Preserving the correct orientation and topology crucial for lateral substrate entry

  • Structural analysis barriers:

    • Challenges in obtaining well-diffracting crystals for X-ray crystallography

    • Maintaining stability during concentration steps required for structural studies

    • Size limitations for NMR analysis of membrane proteins

Future approaches to overcome these challenges should explore:

  • Nanodiscs or other advanced membrane mimetics that better preserve native environments

  • Cell-free expression systems optimized for membrane proteins

  • Fusion partners specifically designed for membrane protein stability

  • Cryo-EM as an alternative method for structural determination that may overcome crystallization barriers

The successful expression and purification of E. coli Lgt, resulting in crystal structures at 1.9 and 1.6 Å resolution , provides a methodological framework that could be adapted for Y. pestis lgt with appropriate modifications to account for species-specific characteristics.

How can researchers design experiments to resolve contradictory data about lgt function?

To resolve contradictory data about lgt function, researchers should implement a systematic experimental design approach that addresses potential sources of variability:

  • Standardization of experimental conditions:

    • Establish consistent protein expression and purification protocols across laboratories

    • Define standard assay conditions (temperature, pH, detergent type, substrate concentrations)

    • Develop reference materials or positive controls for activity assays

  • Multi-method validation:

    • Apply multiple independent techniques to measure the same parameter

    • For example, assess enzymatic activity using radioactive assays, mass spectrometry, and fluorescence-based methods

    • Confirm protein-protein interactions using both in vitro (pull-down, ITC) and in vivo (bacterial two-hybrid) approaches

  • Systematic mutagenesis approach:

    • Create a comprehensive library of point mutations targeting key residues

    • Test each mutant using multiple functional assays

    • Map results onto structural models to identify discrepancies between predicted and observed effects

  • Controlled variables exploration:

    • Systematically vary experimental parameters (detergent type, lipid composition, pH, temperature)

    • Identify conditions that might explain different outcomes between laboratories

    • Determine whether contradictions arise from species-specific or strain-specific variations

  • Statistical rigor and experimental design:

    • Implement principles of optimal experimental design to maximize information content

    • Use appropriate statistical methods for hypothesis testing

    • Consider Bayesian approaches to update confidence in models based on new data

  • Meta-analysis methodology:

    • Formally combine results from multiple studies using meta-analysis techniques

    • Weight evidence based on methodological quality and sample size

    • Identify potential sources of heterogeneity across studies

This systematic approach, combined with transparent reporting of methods and results, would help resolve contradictions in the literature and establish a more robust understanding of lgt function across experimental conditions and bacterial species.

What promising research directions could advance our understanding of Y. pestis lgt for therapeutic applications?

Several promising research directions could significantly advance our understanding of Y. pestis lgt for therapeutic applications:

  • Structure-based inhibitor design:

    • Leverage the high-resolution structures available for E. coli Lgt to develop homology models for Y. pestis lgt

    • Identify unique structural features that could be exploited for selective inhibition

    • Design transition-state mimetics based on the diacylglyceryl transfer reaction

    • Develop fragment-based approaches focusing on the phosphatidylglycerol and lipobox binding sites

  • High-throughput screening platforms:

    • Develop cell-based assays using conditional lgt mutants for compound screening

    • Implement fluorescence-based in vitro assays suitable for large-scale screening campaigns

    • Design targeted libraries enriched for compounds with physicochemical properties suitable for penetrating the Gram-negative cell envelope

  • Combination therapy approaches:

    • Explore synergistic effects between lgt inhibitors and conventional antibiotics

    • Investigate potential for lgt inhibitors to sensitize Y. pestis to immune clearance

    • Develop dual-targeting molecules that simultaneously inhibit lgt and other essential processes

  • Immunological applications:

    • Investigate whether inhibition of lgt alters the immunogenicity of Y. pestis

    • Explore whether partially processed lipoproteins might serve as effective vaccine candidates

    • Determine if lgt inhibition could enhance host recognition of Y. pestis

  • Systems biology integration:

    • Map the complete lipoprotein network in Y. pestis

    • Identify condition-specific expression patterns of lgt and its substrates

    • Develop predictive models of how lipoprotein processing affects various virulence mechanisms

  • Translational research:

    • Establish animal models specifically designed to evaluate lgt inhibitors

    • Develop biomarkers to monitor inhibition of lipoprotein processing in vivo

    • Assess pharmacokinetic/pharmacodynamic relationships for lead compounds targeting lgt

These research directions, pursued in parallel, would create a comprehensive framework for developing lgt-targeted therapeutics against Y. pestis, potentially leading to novel countermeasures against this high-priority pathogen. The essentiality of lgt for bacterial survival, combined with its absence in human cells, makes it a particularly attractive target for antimicrobial development .

What experimental data supports the essentiality of lgt in Y. pestis?

While the search results don't provide Y. pestis-specific experimental data on lgt essentiality, comparative data from related systems can be summarized:

Table 1: Evidence for lgt Essentiality in Bacterial Systems

Bacterial SpeciesExperimental ApproachKey FindingsRelevance to Y. pestis
E. coliComplementation assays with lgt-knockout cellsIdentified critical residues (Arg143, Arg239) essential for diacylglyceryl transfer High sequence conservation suggests similar essential residues in Y. pestis lgt
Multiple Gram-negative bacteriaGene deletion attemptsDeletion of lgt gene is lethal to most Gram-negative bacteria Suggests lgt would be essential in Y. pestis
Y. pestisNlpD lipoprotein studiesDeletion of nlpD (a lipoprotein processed by the pathway initiated by lgt) dramatically reduced virulence Indicates critical role of properly processed lipoproteins in Y. pestis pathogenesis

The essentiality of lgt in multiple Gram-negative bacteria, combined with the critical role of properly processed lipoproteins in Y. pestis virulence, strongly suggests that lgt would be essential in Y. pestis as well. Direct experimental confirmation through conditional knockout systems or CRISPR interference approaches would be valuable future work to conclusively establish lgt essentiality in Y. pestis specifically.

How does enzyme activity of purified Y. pestis lgt compare under different experimental conditions?

Based on general principles of membrane enzyme biochemistry and related studies, the following table presents predicted activity patterns for Y. pestis lgt under various experimental conditions:

Table 2: Predicted Y. pestis lgt Activity Under Different Experimental Conditions

Experimental VariableCondition RangePredicted Effect on ActivityRationale
Temperature4-42°COptimal activity likely at 26-37°C, reflecting Y. pestis lifecycle temperaturesY. pestis transitions between flea vectors (≈26°C) and mammalian hosts (37°C)
pH5.0-9.0Optimal activity likely at pH 6.5-7.5Reflects cytoplasmic membrane environment pH
Detergent typeVariousActivity ranking: native lipids > mild detergents (DDM, LMNG) > harsh detergents (SDS)Membrane protein activity typically correlates with native-like environment
Phospholipid compositionVariousRequirement for phosphatidylglycerol as substrate, potential enhancement with other native lipidsE. coli Lgt crystal structures show specific binding of phosphatidylglycerol
Divalent cations0-10 mMPotential requirement for Mg²⁺ or Mn²⁺ at 1-5 mMCommon cofactors for enzymes involved in phospholipid metabolism
Reducing agents0-10 mMModerate enhancement with DTT or β-mercaptoethanol at 1-5 mMMaintenance of cysteine residues in reduced state may be important for activity

This predictive table provides a framework for systematic exploration of Y. pestis lgt activity determinants. Experimental validation of these predictions would be essential for establishing optimal assay conditions and understanding the enzyme's biochemical requirements.

What structural and functional data exists for key residues in the Y. pestis lgt active site?

While specific data for Y. pestis lgt is not provided in the search results, structural and functional information from the E. coli homolog can be extrapolated due to the likely high conservation of the active site:

Table 3: Key Residues in the lgt Active Site Based on E. coli Data with Predicted Relevance to Y. pestis

Residue (E. coli numbering)Structural RoleFunctional SignificanceEvidencePredicted Conservation in Y. pestis
Arg143Involved in substrate bindingEssential for diacylglyceryl transferComplementation results in lgt-knockout cells Highly likely conserved
Arg239Involved in substrate bindingEssential for diacylglyceryl transferComplementation results in lgt-knockout cells Highly likely conserved
Active site residuesForm binding pockets for phosphatidylglycerol and inhibitorCritical for substrate recognition and catalysisCrystal structures at 1.9 and 1.6 Å resolution Likely conserved in functional domains
Membrane interface residuesFacilitate lateral substrate entryImportant for substrate access from membraneStructural and biochemical data support lateral entry/exit mechanism Likely conserved pattern with possible species-specific adaptations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.